100ideaakevaaseen.fi
Detaljer
Källa: Finlands transport- och kommunikationsbyrå (Traficom) och Internet Assigned Numbers Authority (IANA)Status | Validity expired |
Hållare | PL 21, Finland |
Beviljningsdatum | 2021-01-27 |
Sista giltighetsdatum | 2023-01-27 |
Registrator | Louhi Net Oy 00521 Helsinki |
Namnservrar Se DNS-avsnittet för detaljer | dns1.louhi.net dns2.louhi.net dns3.louhi.fi |
Är DNSSec i bruk | No |
IANA detaljer för suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP
Källa: Faktisk webbsida - Tidsstämpel: 2022-09-18 02:33VARNING: Observera att platsen kan vara helt fel om servern använder t.ex. omvänd proxy som Cloudflare
Server IP not valid or missing details in database. Map not shown
Word cloud för 100ideaakevaaseen.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-09-18 02:33Lägga märke till: Diverse ord tas bort från molnet för att förbättra analysen
Webbsida information för 100ideaakevaaseen.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-02-26 14:25Header data & Metataggar | title Etusivu | Puutarha robots index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1 viewport width=device-width, initial-scale=1.0, maximum-scale=2.0 generator WPML ver:4.4.12 stt:2,53; not_found emptyIE=edge,chrome=1. fi_FI. website. Etusivu | Puutarha. https://puutarha.messukeskus.com/. Puutarha. https://www.facebook.com/Messukeskus. 2021-02-24T11:03:18+00:00. theme-color #ffffff msapplication-config https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/img/icons/browserconfig.xml msapplication-tilecolor #ffffff |
Öppna graf (OG) metataggar | og:url https://puutarha.messukeskus.com/ og:type website og:title Etusivu | Puutarha og:locale fi_FI og:site_name Puutarha |
Twitter-kort | twitter:card summary_large_image twitter:site @messukeskus |
Cascading Style Sheets (CSS) (CSS) | https://puutarha.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/animate.css https://puutarha.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/all.css https://api.tiles.mapbox.com/mapbox-gl-js/v0.53.1/mapbox-gl.css https://puutarha.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/material-design.css https://puutarha.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/chart.css https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/fonts/fontello/css/animation.css https://use.fontawesome.com/releases/v5.0.6/css/all.css https://puutarha.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/style.css?v //fast.fonts.net/cssapi/14fe8344-4391-401a-8913-ec217785557d.css https://puutarha.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/bsa.carousel.css https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/fonts/fontello/css/fontello.css?20181003-1 https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/remodal/dist/remodal.css https://puutarha.messukeskus.com/wp-includes/css/dist/block-library/style.min.css https://puutarha.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/ui-datapicker.css https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/dist/css/main.1641899936.css https://puutarha.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/css/asset/user-panel.css |
Länkar till sociala medier (SOME) | Att ha innehåll i sociala medier rekommenderas starkt för sökmotoroptimering (SEO) |
JavaScript-bibliotek | https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/dist/js/myquery.1641899936.js https://puutarha.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/js/jquery.viewportchecker.js https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/remodal/dist/remodal.min.js https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/slick.js/slick/slick.min.js https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/perfect-scrollbar/js/perfect-scrollbar.jquery.min.js https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/sticky-kit/jquery.sticky-kit.min.js https://puutarha.messukeskus.com/wp-includes/js/shortcode.min.js https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/chart.js/chart.min.js //cdnjs.cloudflare.com/ajax/libs/modernizr/2.8.3/modernizr.min.js https://puutarha.messukeskus.com/wp-includes/js/jquery/jquery.min.js https://puutarha.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/js/bsa.carousel.js https://ajax.googleapis.com/ajax/libs/jquery/1.11.3/jquery.min.js https://puutarha.messukeskus.com/wp-includes/js/jquery/jquery-migrate.min.js https://puutarha.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/js/script.js https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/countup.js/dist/countup.min.js https://puutarha.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/js/chart.js https://puutarha.messukeskus.com/wp-admin/js/media-upload.min.js https://puutarha.messukeskus.com/wp-includes/js/thickbox/thickbox.js https://puutarha.messukeskus.com/wp-includes/js/jquery/ui/datepicker.min.js https://puutarha.messukeskus.com/wp-includes/js/dist/vendor/moment.min.js https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/vegas/dist/vegas.min.js https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/jquery-date-range-picker/jquery.daterangepicker.js https://puutarha.messukeskus.com/wp-includes/js/jquery/ui/core.min.js https://cdn.cookielaw.org/langswitch/e574c5d1-f15f-4df9-8e85-6044a9e59ce4.js https://puutarha.messukeskus.com/wp-includes/js/imagesloaded.min.js https://puutarha.messukeskus.com/wp-includes/js/masonry.min.js https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/velocity/velocity.min.js https://puutarha.messukeskus.com/wp-content/themes/messukeskus/assets/vendor/hammerjs/hammer.min.js https://puutarha.messukeskus.com/wp-includes/js/clipboard.min.js https://puutarha.messukeskus.com/wp-content/plugins/bsa-plugin-pro-scripteo/frontend/js/jquery.simplyscroll.js https://puutarha.messukeskus.com/wp-includes/js/underscore.min.js |
Cookie-data för 100ideaakevaaseen.fi
Källa: Faktisk webbsida - Tidsstämpel: 2022-02-26 14:25Antal kakor: 28
Cookie-domän | Cookievärden |
---|---|
adform.net | Cookie name: C Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 2 bitgrupper |
adform.net | Cookie name: uid Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 22 bitgrupper |
ads.linkedin.com | Cookie name: lang Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 18 bitgrupper |
doubleclick.net | Cookie name: IDE Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 70 bitgrupper |
fonts.net | Cookie name: __cf_bm Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 152 bitgrupper |
hubspot.com | Cookie name: __cf_bm Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 152 bitgrupper |
linkedin.com | Cookie name: AnalyticsSyncHistory Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 106 bitgrupper |
linkedin.com | Cookie name: UserMatchHistory Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 94 bitgrupper |
messukeskus.com | Cookie name: _gcl_au Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 32 bitgrupper |
messukeskus.com | Cookie name: __hstc Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 92 bitgrupper |
messukeskus.com | Cookie name: OptanonConsent Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 753 bitgrupper |
messukeskus.com | Cookie name: _hjSessionUser_417628 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 137 bitgrupper |
messukeskus.com | Cookie name: __hssrc Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 8 bitgrupper |
messukeskus.com | Cookie name: hubspotutk Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 42 bitgrupper |
messukeskus.com | Cookie name: _hjAbsoluteSessionInProgress Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 29 bitgrupper |
messukeskus.com | Cookie name: _fbp Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 33 bitgrupper |
messukeskus.com | Cookie name: _hjSession_417628 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 133 bitgrupper |
messukeskus.com | Cookie name: _hjFirstSeen Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 13 bitgrupper |
messukeskus.com | Cookie name: _gat_gtag_UA_11620821_12 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 25 bitgrupper |
messukeskus.com | Cookie name: _gat_UA-11620821-14 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 20 bitgrupper |
messukeskus.com | Cookie name: _dc_gtm_UA-11620821-8 Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 22 bitgrupper |
messukeskus.com | Cookie name: _gid Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 31 bitgrupper |
messukeskus.com | Cookie name: _ga Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 29 bitgrupper |
messukeskus.com | Cookie name: __hssc Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 31 bitgrupper |
puutarha.messukeskus.com | Cookie name: _hjIncludedInPageviewSample Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 28 bitgrupper |
puutarha.messukeskus.com | Cookie name: _hjIncludedInSessionSample Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 27 bitgrupper |
youtube.com | Cookie name: YSC Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 14 bitgrupper |
youtube.com | Cookie name: VISITOR_INFO1_LIVE Cookie expiry/purpose: Session cookie (tas bort efter sessionens slut) Cookie size: 29 bitgrupper |
Skärmdump för 100ideaakevaaseen.fi
DNS-poster för 100ideaakevaaseen.fi
Källa: DNS-svar - Tidsstämpel: 2022-09-18 02:33A | 100ideaakevaaseen.fi 188.117.27.178 (Time to Live: 3600) |
MX | 100ideaakevaaseen.fi (Time to Live: 3600) |
NS | dns1.louhi.net
|
SOA | 100ideaakevaaseen.fi dns1.louhi.net (Time to Live: 3600) hostmaster.louhi.net |
Whois rekordhistoria för 100ideaakevaaseen.fi
Källa: Finlands transport- och kommunikationsbyrå (Traficom)Visar senaste max 5 upptäckte förändringar i posterna. Ändringar markeras
Datum | 2021-01-28 | 2021-12-22 | 2023-01-28 |
---|---|---|---|
Name | 100ideaakevaaseen.fi | 100ideaakevaaseen.fi | 100ideaakevaaseen.fi |
State | Registered | Registered | Validity expired |
Holder | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta |
Address | PL 21 | PL 21 | PL 21 |
Country | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2021-01-27T09:00:52.3 | 2021-01-27T09:00:52.3 | 2021-01-27T09:00:52.3 |
Registrar | Louhi Net Oy | Louhi Net Oy | Louhi Net Oy |
PostalArea | Helsinki | Helsinki | Helsinki |
PostalCode | 00521 | 00521 | 00521 |
NameServer1 | dns1.louhi.net | dns1.louhi.net | dns1.louhi.net |
NameServer2 | dns2.louhi.net | dns2.louhi.net | dns2.louhi.net |
NameServer3 | dns3.louhi.fi | dns3.louhi.fi | dns3.louhi.fi |
PhoneNumber | |||
IsDNSSecInUse | no | no | no |
OrganizationId | 0116322-3 | 0116322-3 | 0116322-3 |
AssociationType | Company | Company | Company |
LastValidityDate | 2022-01-27T09:00:52.3 | 2023-01-27T09:00:52.3 | 2023-01-27T09:00:52.3 |
DepartmentOrContactPerson |
Server svar för 100ideaakevaaseen.fi
Källa: Webbserversvar - Tidsstämpel: 2022-09-18 02:33Slutlig URL | |
HTTP-returkod | |
IP-adress | |
Serverhuvud | Server: Via: |
Certifikat | Inte tillgänglig Att använda certifikat rekommenderas starkt för sökmotoroptimering (SEO) Om din webbplats har ett certifikat och du fortfarande ser denna varning betyder det att din webbserver inte är konfigurerad korrekt för att omdirigera trafik till en https-adress |
Begagnade tekniker på 100ideaakevaaseen.fi
Källa: Webbsideanalys - Tidsstämpel: 2022-09-18 02:33Senaste recensionen | 2022-09-18 02:33 |
Sidspråk (från rubrik) | (Detta är ofta falskt!) |
Technologies |
Kända underdomäner för 100ideaakevaaseen.fi
Källa: Sökmotorer och DNS-poster (MEDDELANDE: De flesta kanske inte kan nås (internt / DMZ / föråldrat)). Visar max rader 700Inga underdomäner hittades
Webbhotellleverantörer
Källa: Alla giltiga företagswebbplatser med innehåll (se tabellen nedan)
Domäner som ägs av samma ägare (nuvarande och tidigare)
Källa: Finlands transport- och kommunikationsbyrå (Traficom)Antal domäner: 282
Domän namn | Slutlig URL (när sist testades) | Länkar | Sista giltighet |
---|---|---|---|
100ideaakevaaseen.fi | Utgånget 2023-01-27 | ||
55plus.fi | Inga DNS-poster hittades | 2025-02-09 | |
agriexpo.fi | Utgånget 2023-11-23 | ||
agrikone.fi | Utgånget 2023-11-23 | ||
agrikonemessut.fi | Utgånget 2023-11-23 | ||
agrimessut.fi | Utgånget 2023-11-23 | ||
antiikkitapahtuma.fi | http://antiikki.messukeskus.com/ | 2024-11-27 | |
apconfinland.fi | Utgånget 2021-08-16 | ||
arenaexpo.fi | https://arena.messukeskus.com/ | 2024-06-14 | |
asujaremontoi.fi | Inga DNS-poster hittades | 2024-10-25 | |
atvmessut.fi | Utgånget 2023-03-29 | ||
auto2017.fi | Utgånget 2000-12-31 | ||
auto2019.fi | http://auto.messukeskus.com/ | 2026-02-08 | |
auto2020.fi | Utgånget 2024-02-08 | ||
auto2021.fi | Utgånget 2024-02-08 | ||
auto2022.fi | Utgånget 2024-02-08 | ||
autokorjaamomessut.fi | https://autokorjaamo.messukeskus.com/ | 2024-09-20 | |
automaatiomessut.fi | Utgånget 2023-09-20 | ||
auto-messut.fi | http://auto.messukeskus.com/ | 2025-01-26 | |
båtmässa.fi | Inga DNS-poster hittades | 2024-09-01 | |
beautyprocover.fi | http://iloveme.messukeskus.com/beauty-pro/ | 2025-05-03 | |
beautypromessut.fi | Inga DNS-poster hittades | 2024-12-01 | |
bioenergyexpo.fi | Utgånget 2023-11-18 | ||
bioproductsexpo.fi | Utgånget 2023-11-18 | ||
bisnespaivat.fi | Utgånget 2024-01-03 | ||
bisnespäivät.fi | https://messukeskus.com/wp-signup.php?new=www.xn--bisnespivt... | 2026-01-03 | |
bolearenaclub.fi | Inga DNS-poster hittades | 2025-05-11 | |
bolearena.fi | Inga DNS-poster hittades | 2025-05-11 | |
böle.fi | Inga DNS-poster hittades | 2025-05-11 | |
businesstravelforum.fi | https://matka.messukeskus.com/b2b/ | 2024-05-22 | |
caravanmessut.fi | https://caravan.messukeskus.com/ | 2024-09-20 | |
chembiofinland.fi | http://chembio.messukeskus.com/ | 2025-02-19 | |
congresscenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
congresscentre.fi | Utgånget 2023-09-05 | ||
conventioncenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
conventioncentre.fi | https://messukeskus.com/wp-signup.php?new=www.conventioncent... | 2027-06-13 | |
corefair.fi | Utgånget 2018-04-16 | ||
coremessut.fi | Utgånget 2018-04-16 | ||
digiexpo.fi | Utgånget 2024-02-19 | ||
educafair.fi | Inga DNS-poster hittades | 2024-10-28 | |
educamessut.fi | Inga DNS-poster hittades | 2025-04-07 | |
elainystavani.fi | Inga DNS-poster hittades | 2025-05-20 | |
eläinystäväni.fi | Inga DNS-poster hittades | 2025-05-20 | |
elmamessut.fi | https://elma.messukeskus.com/ | 2024-09-05 | |
eltekmessut.fi | Utgånget 2023-09-04 | ||
emessukeskus.fi | http://www.emessukeskus.fi/ | 2025-03-27 | |
enviroexpo.fi | Utgånget 2024-01-29 | ||
facetoface.fi | Utgånget 2023-09-07 | ||
fairnet.fi | Utgånget 2023-09-04 | ||
fillarimessut.fi | https://goexpo.messukeskus.com/ | 2024-09-05 | |
finlandsmassa.fi | Utgånget 2023-09-04 | ||
finlandsmässa.fi | Utgånget 2023-09-01 | ||
finnbuild.fi | Inga DNS-poster hittades | 2024-09-04 | |
finnexpo.fi | Utgånget 2023-08-31 | ||
finnishdentalexhibition.fi | Inga DNS-poster hittades | 2024-11-17 | |
finnishfaircorporation.fi | https://messukeskus.com/wp-signup.php?new=www.finnishfaircor... | 2024-09-04 | |
finnsec.fi | http://www.finnsec.fi/ | 2024-09-04 | |
foodtechelsinki.fi | https://pfsptec.messukeskus.com/ | 2025-04-07 | |
formakevat.fi | Utgånget 2023-09-03 | ||
formakevät.fi | Utgånget 2023-09-03 | ||
formasyksy.fi | Utgånget 2023-09-03 | ||
funexpo.fi | http://www.funexpo.fi/ | 2024-09-28 | |
gamexpo.fi | Utgånget 2023-11-17 | ||
gastro.fi | Inga DNS-poster hittades | 2024-09-04 | |
gastrohelsinki.fi | Inga DNS-poster hittades | 2025-03-20 | |
gastropro.fi | https://gastro.messukeskus.com/ | 2024-11-01 | |
globalworkshop.fi | https://matka.messukeskus.com/ | 2024-10-25 | |
goexpo.fi | https://goexpo.messukeskus.com/ | 2025-12-04 | |
goexpohorse.fi | Utgånget 2023-12-06 | ||
goexpowinter.fi | Utgånget 2023-10-17 | ||
golfexpo.fi | Utgånget 2024-03-05 | ||
golfmessut.fi | https://golfmessut.fi/ | 2024-09-05 | |
graftec.fi | Utgånget 2024-04-22 | ||
growthhelsinki.fi | Utgånget 2023-02-07 | ||
gswpro.fi | Utgånget 2000-12-31 | ||
habitare.fi | Inga DNS-poster hittades | 2024-08-31 | |
habitarepro.fi | http://www.habitarepro.fi/ | 2024-09-22 | |
hammalääkäripäivätnäyttely.fi | Utgånget 2018-11-15 | ||
hammaslaakaripaivatnayttely.fi | Inga DNS-poster hittades | 2024-11-15 | |
hammaslääkäripäivätnäyttely.fi | https://hammaslaakaripaivat.messukeskus.com/ | 2024-11-25 | |
helsingforsbokmassa.fi | https://kirjamessut.messukeskus.com/?lang=sv | 2024-09-05 | |
helsingforsbokmässa.fi | https://messukeskus.com/wp-signup.php?new=www.xn--helsingfor... | 2024-09-01 | |
helsingforsmasscentrum.fi | Inga DNS-poster hittades | 2024-09-04 | |
helsingforsmässcentrum.fi | Utgånget 2019-09-01 | ||
helsingineramessut.fi | Inga DNS-poster hittades | 2025-04-19 | |
helsinginerämessut.fi | Inga DNS-poster hittades | 2025-04-19 | |
helsinginkirjamessut.fi | https://kirjamessut.messukeskus.com/ | 2024-09-05 | |
helsinginmessukeskus.fi | Inga DNS-poster hittades | 2024-08-31 | |
helsinginmessut.fi | http://www.wanhasatama.com/ | 2024-08-31 | |
helsinginmetsamessut.fi | Utgånget 2024-01-08 | ||
helsinginmetsämessut.fi | Utgånget 2024-01-08 | ||
helsinginmusiikkimessut.fi | Utgånget 2023-10-22 | ||
helsinkiboatshow.fi | Inga DNS-poster hittades | 2024-11-17 | |
helsinkibookfair.fi | Inga DNS-poster hittades | 2024-09-05 | |
helsinkicf.fi | Inga DNS-poster hittades | 2025-04-07 | |
helsinkiconventioncenter.fi | Inga DNS-poster hittades | 2025-06-13 | |
helsinkiconventioncentre.fi | Inga DNS-poster hittades | 2025-06-13 | |
helsinkiexhibitionandconventioncenter.fi | https://messukeskus.com/?lang=en | 2025-06-13 | |
helsinkiexhibitionandconventioncentre.fi | http://www.helsinkiexhibitionandconventioncentre.fi/ | 2025-06-13 | |
helsinkiexhibitioncenter.fi | Inga DNS-poster hittades | 2024-06-13 | |
helsinkiexhibitioncentre.fi | Inga DNS-poster hittades | 2025-06-13 | |
helsinkifaircentre.fi | http://messukeskus.com/?lang=en | 2024-09-04 | |
helsinkihorsefair.fi | http://www.helsinkihorsefair.fi/ | 2024-09-20 | |
highendhelsinki.fi | Utgånget 2024-01-18 | ||
highendhifi.fi | Utgånget 2024-01-16 | ||
himss.fi | Inga DNS-poster hittades | 2024-11-16 | |
horsefair.fi | Utgånget 2024-04-23 | ||
hpmessut.fi | http://www.hpmessut.fi/ | 2024-06-07 | |
hupicon.fi | Inga DNS-poster hittades | 2024-10-06 | |
iloveme.fi | http://iloveme.messukeskus.com/ | 2025-01-18 | |
infraexpo.fi | Utgånget 2024-01-31 | ||
jatevesiymparisto.fi | Inga DNS-poster hittades | 2024-09-04 | |
jätevesiympäristö.fi | http://www.xn--jtevesiymprist-5hbj42a.fi/ | 2024-09-04 | |
jewelandwatch.fi | Utgånget 2023-11-27 | ||
jobforum.fi | Utgånget 2023-10-22 | ||
jointec.fi | Utgånget 2024-04-24 | ||
jonnela.fi | Inga DNS-poster hittades | 2024-10-30 | |
jonnelaklubi.fi | Inga DNS-poster hittades | 2024-10-30 | |
julkinenateria.fi | https://ateria.messukeskus.com/ | 2024-11-25 | |
julkisivumessut.fi | Utgånget 2019-01-18 | ||
kadentaitotapahtuma.fi | Utgånget 2024-02-26 | ||
kädentaitotapahtuma.fi | Utgånget 2024-02-26 | ||
kauneusmessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
kevaanmerkit.fi | Utgånget 2024-03-30 | ||
keväänmerkit.fi | Utgånget 2024-03-30 | ||
kevatmessut.fi | http://www.kevatmessut.fi/ | 2025-01-08 | |
kevätmessut.fi | http://www.xn--kevtmessut-s5a.fi/ | 2025-01-08 | |
kevatpuutarha.fi | http://kevatmessut.messukeskus.com/ | 2024-09-04 | |
kiinteistoklusteri.fi | Utgånget 2024-03-29 | ||
kiinteistöklusteri.fi | Utgånget 2024-03-29 | ||
kiinteistomessut.fi | http://www.kiinteistomessut.fi/ | 2024-09-20 | |
kiinteistömessut.fi | Inga DNS-poster hittades | 2024-09-01 | |
kiinteistoplusturvallisuus.fi | Utgånget 2024-03-05 | ||
kiinteistöplusturvallisuus.fi | Utgånget 2024-03-05 | ||
kokoustamo.fi | Utgånget 2023-09-25 | ||
korjausjarakentaminen.fi | Utgånget 2023-09-07 | ||
korjausrakentaminen2018.fi | Utgånget 2023-10-04 | ||
korujakello.fi | Utgånget 2023-11-27 | ||
korujakellomessut.fi | Utgånget 2023-11-27 | ||
kuljetuslogistiikka.fi | Utgånget 2023-09-05 | ||
kutsutapahtumaan.fi | Inga DNS-poster hittades | 2024-10-25 | |
laakaripaivatnayttely.fi | https://laakaripaivat.messukeskus.com/ | 2024-09-20 | |
lääkäripäivätnäyttely.fi | Inga DNS-poster hittades | 2025-09-01 | |
lahiruokaluomu.fi | https://lahiruokajaluomu.messukeskus.com/ | 2024-09-21 | |
lähiruokaluomu.fi | https://kevatmessut.messukeskus.com/ | 2024-09-21 | |
lapsimessut.fi | https://lapsimessut.messukeskus.com/ | 2024-09-05 | |
lautasella.fi | Inga DNS-poster hittades | 2025-06-08 | |
lemmikkitapahtuma.fi | Inga DNS-poster hittades | 2024-12-16 | |
liikelahjamessut.fi | Utgånget 2019-10-30 | ||
liikelahjatmessut.fi | Utgånget 2019-10-30 | ||
logistiikkakuljetus.fi | Utgånget 2023-09-05 | ||
maatalouskonemessut.fi | https://maatalouskone.messukeskus.com/ | 2024-11-23 | |
maintec.fi | Utgånget 2018-04-22 | ||
manufacturingmaterials.fi | Utgånget 2023-10-30 | ||
markkinoinninviikko.fi | Utgånget 2024-03-09 | ||
matkahuutokauppa.fi | Utgånget 2019-12-13 | ||
matkailupalkinto.fi | Utgånget 2018-11-30 | ||
matkamessut.fi | Inga DNS-poster hittades | 2024-09-05 | |
matkapro.fi | Inga DNS-poster hittades | 2024-11-20 | |
maxpo.fi | http://www.maxpo.fi/ | 2024-09-04 | |
mecatec.fi | Utgånget 2023-08-31 | ||
meetfinland.fi | Inga DNS-poster hittades | 2024-09-28 | |
meidanviikonloppu.fi | Utgånget 2024-02-18 | ||
meidänviikonloppu.fi | Utgånget 2024-02-18 | ||
mesoaja.fi | http://www.mesoaja.fi/ | 2024-07-31 | |
messuhelmi.fi | Utgånget 2018-05-29 | ||
messukeskus100.fi | Utgånget 2023-11-20 | ||
messukeskushelsinki.fi | Inga DNS-poster hittades | 2024-10-10 | |
messukirppis.fi | Utgånget 2019-02-06 | ||
messuklubi.fi | Inga DNS-poster hittades | 2024-09-18 | |
messukutsu.fi | Inga DNS-poster hittades | 2024-05-22 | |
messumedia.fi | http://www.messumedia.fi/ | 2024-09-04 | |
messuparkki.fi | Inga DNS-poster hittades | 2025-05-29 | |
messut100.fi | Inga DNS-poster hittades | 2025-12-13 | |
messutapahtumat.fi | Inga DNS-poster hittades | 2024-09-20 | |
messuvalmennus.fi | Inga DNS-poster hittades | 2025-01-14 | |
metsamessut.fi | https://metsa.messukeskus.com/ | 2025-05-16 | |
metsämessut.fi | Inga DNS-poster hittades | 2024-05-16 | |
metsastysmessut.fi | Utgånget 2024-04-22 | ||
metsästysmessut.fi | Utgånget 2019-04-22 | ||
model-expo.fi | Utgånget 2023-10-14 | ||
modelexpo.fi | Utgånget 2023-10-14 | ||
moottorikelkkamessut.fi | Utgånget 2024-03-29 | ||
moottoripyoranayttely.fi | Utgånget 2024-02-19 | ||
moottoripyöränäyttely.fi | Inga DNS-poster hittades | 2024-09-01 | |
motokuume.fi | http://www.motokuume.fi/ | 2024-12-04 | |
motokuumemittari.fi | Utgånget 2024-01-21 | ||
mp-messut.fi | Inga DNS-poster hittades | 2024-09-29 | |
mpmessut.fi | http://mp.messukeskus.com/ | 2025-02-21 | |
mp-nayttely.fi | http://www.mp-nayttely.fi/ | 2025-02-19 | |
mprock.fi | Utgånget 2023-06-21 | ||
mpstars.fi | Utgånget 2023-11-02 | ||
muotimessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
nayttely.fi | Utgånget 2023-09-05 | ||
nbe.fi | Utgånget 2023-09-11 | ||
nordictravelfair.fi | http://matka.messukeskus.com/?lang=en | 2024-10-06 | |
oispatalvi.fi | http://www.oispatalvi.fi/ | 2024-09-14 | |
omakotimessut.fi | http://kevatmessut.messukeskus.com/ | 2024-09-20 | |
omamokki.fi | Inga DNS-poster hittades | 2024-09-04 | |
omamökki.fi | Inga DNS-poster hittades | 2024-09-01 | |
omapiha.fi | Inga DNS-poster hittades | 2024-09-04 | |
onseala.fi | Inga DNS-poster hittades | 2025-03-21 | |
outdoorexpo.fi | http://www.outdoorexpo.fi/ | 2024-12-16 | |
pactec.fi | Inga DNS-poster hittades | 2024-08-31 | |
petrolcircus.fi | Inga DNS-poster hittades | 2024-11-17 | |
plastexpo.fi | Utgånget 2023-09-24 | ||
pomppulinnataivas.fi | Utgånget 2023-10-25 | ||
pranabeats.fi | Utgånget 2019-10-13 | ||
pratkakuume.fi | Utgånget 2018-06-08 | ||
promoexpo.fi | Utgånget 2023-11-21 | ||
pulpandbeyond.fi | Inga DNS-poster hittades | 2025-05-11 | |
pulpaper.fi | Inga DNS-poster hittades | 2024-09-04 | |
pwaexpo.fi | Utgånget 2021-04-27 | ||
pwa.fi | Utgånget 2024-04-27 | ||
reset16.fi | Utgånget 2020-01-29 | ||
reset17.fi | Utgånget 2019-08-18 | ||
reset2017.fi | Utgånget 2019-08-17 | ||
retkimessut.fi | Utgånget 2024-02-19 | ||
robtec.fi | Utgånget 2000-12-31 | ||
ruokamessuthelsinki.fi | Inga DNS-poster hittades | 2025-01-09 | |
sahko-electricity.fi | Inga DNS-poster hittades | 2025-03-25 | |
sähkö-electricity.fi | Inga DNS-poster hittades | 2025-03-25 | |
sahkoexpo.fi | http://www.sahkoexpo.fi/ | 2025-03-25 | |
sähköexpo.fi | Inga DNS-poster hittades | 2025-03-25 | |
sähkömessut.fi | Inga DNS-poster hittades | 2025-02-15 | |
sairaanhoitajapaivatnayttely.fi | Inga DNS-poster hittades | 2025-04-20 | |
sairaanhoitajapäivätnäyttely.fi | Inga DNS-poster hittades | 2025-04-20 | |
seatechelsinki.fi | Utgånget 2000-12-31 | ||
secd-day.fi | Inga DNS-poster hittades | 2025-02-19 | |
seonala.fi | Inga DNS-poster hittades | 2025-04-19 | |
showroomfair.fi | Utgånget 2023-11-23 | ||
signtec.fi | Utgånget 2024-01-29 | ||
sihteeriassistenttimessut.fi | Utgånget 2023-10-30 | ||
sihteeriassistenttipaivat.fi | Utgånget 2023-10-30 | ||
sihteeriassistenttipäivät.fi | Utgånget 2023-10-30 | ||
sijoittaja23.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittaja25.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittaja26.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittaja27.fi | Inga DNS-poster hittades | 2025-05-15 | |
sijoittajamessut.fi | https://sijoittajamessut.messukeskus.com/ | 2025-01-08 | |
sisahuvipuisto.fi | Inga DNS-poster hittades | 2024-06-13 | |
sisustamessut.fi | https://kevatmessut.messukeskus.com/ | 2024-06-14 | |
sporttitaivas.fi | https://messukeskus.com/wp-signup.php?new=www.sporttitaivas.... | 2024-06-15 | |
studiamessut.fi | http://studia.messukeskus.com/ | 2024-10-29 | |
suomenmessut.fi | http://messukeskus.com/ | 2024-08-31 | |
suomenmetsamessut.fi | Inga DNS-poster hittades | 2025-07-03 | |
suomenmetsämessut.fi | Inga DNS-poster hittades | 2024-07-03 | |
suomenvideoviestinta.fi | http://www.suomenvideoviestinta.fi/ | 2024-08-24 | |
svv.fi | https://svv.fi/ | 2024-09-04 | |
tanssiviekoon.fi | Utgånget 2023-12-22 | ||
teknologia17.fi | Utgånget 2019-03-19 | ||
teknologia19.fi | Utgånget 2024-03-19 | ||
teknologia21.fi | https://teknologia.messukeskus.com/ | 2024-10-16 | |
teknologia22.fi | Inga DNS-poster hittades | 2024-09-28 | |
teknologia23.fi | Inga DNS-poster hittades | 2025-02-20 | |
teknologiatapahtuma.fi | Inga DNS-poster hittades | 2024-08-16 | |
tempaudu.fi | Inga DNS-poster hittades | 2024-08-14 | |
terveysmessut.fi | Inga DNS-poster hittades | 2024-09-04 | |
terveytesimessut.fi | Inga DNS-poster hittades | 2024-06-08 | |
tooltec.fi | https://teknologia.messukeskus.com/ | 2026-05-08 | |
travelfair.fi | http://www.travelfair.fi/ | 2024-10-06 | |
tsigaboom.fi | https://tsigaboom.messukeskus.com/ | 2024-08-15 | |
turvallisuus2021.fi | Utgånget 2023-04-09 | ||
turvallisuusmessut2021.fi | Utgånget 2023-04-09 | ||
turvallisuustapahtuma.fi | Inga DNS-poster hittades | 2024-09-27 | |
valomessut.fi | http://www.valomessut.fi/ | 2027-03-30 | |
valotapahtuma.fi | Utgånget 2024-03-30 | ||
varipinta.fi | Utgånget 2023-09-05 | ||
väripinta.fi | Utgånget 2023-09-01 | ||
venemessut.fi | http://vene.messukeskus.com/ | 2024-09-04 | |
vihertek.fi | Utgånget 2023-11-04 | ||
viiniexpo.fi | Utgånget 2023-09-04 | ||
viiniruoka.fi | http://www.viiniruoka.fi/ | 2025-04-28 | |
visitmatka.fi | Inga DNS-poster hittades | 2024-08-31 | |
winterexpo.fi | Utgånget 2023-10-17 | ||
woodexpo.fi | Utgånget 2023-11-18 | ||
ymparistomessut.fi | Utgånget 2023-09-05 | ||
ympäristömessut.fi | Utgånget 2023-09-01 | ||
ymparistotekniikkamessut.fi | http://www.ymparistotekniikkamessut.fi/ | 2024-06-06 | |
ympäristötekniikkamessut.fi | https://messukeskus.com/wp-signup.php?new=www.xn--ympristtek... | 2024-06-06 | |
yritys2017.fi | Utgånget 2021-02-03 | ||
yritys2018.fi | Inga DNS-poster hittades | 2027-01-26 |