loistotaksi.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)State | Validity expired |
Holder | Puurtajankuja 3 D 50, Finland |
Grant Date | 2021-01-12 |
Last Validity Date | 2022-01-12 |
Registrar | Euronic Oy 04440 Jarvenpaa |
Name Servers Please see DNS section for details | dnssec1.euronic.fi dnssec2.euronic.fi dnssec3.euronic.fi |
Is The DNSSec in Use | No |
IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2021-11-17 03:57WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
Server IP not valid or missing details in database. Map not shown
Word cloud for loistotaksi.fi
Sorry, not enough data to parse a word cloud for this site at this time
Web page details for loistotaksi.fi
Source: Actual web page - Timestamp: Header data & Meta tags | |
Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
Cascading Style Sheets (CSS) (CSS) | |
Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
JavaScript libraries |
Screenshot for loistotaksi.fi
DNS records for loistotaksi.fi
Source: DNS reponse - Timestamp: 2021-11-17 03:57
Whois record history for loistotaksi.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
Date | 2021-01-13 | 2021-01-19 | 2022-01-13 |
---|---|---|---|
Name | loistotaksi.fi | loistotaksi.fi | loistotaksi.fi |
State | Registered | Registered | Validity expired |
Holder | Petax Oy | Petax Oy | Petax Oy |
Address | Puurtajankuja 3 D 50 | Puurtajankuja 3 D 50 | Puurtajankuja 3 D 50 |
Country | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2021-01-12T15:39:40.837 | 2021-01-12T15:39:40.837 | 2021-01-12T15:39:40.837 |
Registrar | Euronic Oy | Euronic Oy | Euronic Oy |
PostalArea | Jarvenpaa | Jarvenpaa | Jarvenpaa |
PostalCode | 04440 | 04440 | 04440 |
NameServer1 | dnssec1.euronic.fi | dnssec1.euronic.fi | dnssec1.euronic.fi |
NameServer2 | dnssec2.euronic.fi | dnssec2.euronic.fi | dnssec2.euronic.fi |
NameServer3 | dnssec3.euronic.fi | dnssec3.euronic.fi | dnssec3.euronic.fi |
PhoneNumber | +358.458580444 | ||
IsDNSSecInUse | no | no | no |
OrganizationId | 2589601-8 | 2589601-8 | 2589601-8 |
AssociationType | Company | Company | Company |
LastValidityDate | 2022-01-12T15:39:40.837 | 2022-01-12T15:39:40.837 | 2022-01-12T15:39:40.837 |
DepartmentOrContactPerson |
Server response for loistotaksi.fi
Source: Web server reponse - Timestamp: 2021-11-17 03:57Final URL | |
HTTP Return Code | |
IP Address | |
Server Header | Server: Via: |
Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on loistotaksi.fi
Source: Web page analysis - Timestamp: 2021-11-17 03:57Latest review | 2021-11-17 03:57 |
Page language (from header) | fi (This is often false!) |
Technologies | Font Awesome (Font Scripts) (100% propable) Google Analytics (Analytics) (100% propable) Google Font API (Font Scripts) (100% propable) Google Tag Manager (Tag Managers) (100% propable) Magento (Ecommerce) (100% propable) Nginx 1.14.1 (Web ServersReverse Proxy) (100% propable) PHP 7.4.6 (Programming Languages) (100% propable) RequireJS 2.1.11 (JavaScript Frameworks) (100% propable) |
Known subdomains for loistotaksi.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700No subdomains found
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 11
Domain name | Final URL (when last tested) | Links | Last validity |
---|---|---|---|
brilliancytaxi.fi | Expired 2022-01-12 | ||
jarvenpaantaksiammattilaiset.fi | No DNS records found | 2024-07-03 | |
loistotaksi.fi | Expired 2022-01-12 | ||
petax.fi | http://petax.fi/ | 2025-02-12 | |
petaxlahti.fi | http://petaxlahti.fi/ | 2024-11-27 | |
petaxrent.fi | No DNS records found | 2024-06-16 | |
petterintaksi.fi | http://www.petterintaksi.fi/ | 2025-02-01 | |
taksille.fi | No DNS records found | 2025-06-05 | |
taxibrilliancy.fi | Expired 2022-01-12 | ||
teidentukko.fi | https://petaxrent.fi/ | 2024-06-23 | |
varataksit.fi | http://petaxlahti.fi/ | 2025-02-13 |