koulupsykologipalvelu.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)| State | Registered |
| Holder | Köydenpunojankatu 2 B 8, Finland |
| Grant Date | 2014-08-20 |
| Last Validity Date | 2024-08-20 |
| Registrar | Planeetta Internet Oy 20100 Turku |
| Name Servers Please see DNS section for details | ns1.hostingpalvelu.fi ns2.hostingpalvelu.fi |
| Is The DNSSec in Use | No |
| IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2022-11-28 03:18WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
Server IP not valid or missing details in database. Map not shown
Word cloud for koulupsykologipalvelu.fi
Source: Actual web page - Timestamp: 2022-11-28 03:18Notice: Miscellaneous words removed from the cloud to enhance the analytics
Web page details for koulupsykologipalvelu.fi
Source: Actual web page - Timestamp: 2022-11-21 09:55| Header data & Meta tags | title VIRHE: Pyydettyä URL-osoitetta ei voitu hakea not_found Copyright (C) 1996-2019 The Squid Software Foundation and contributorstext/html; charset=utf-8. |
| Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
| Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
| Cascading Style Sheets (CSS) (CSS) | |
| Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
| JavaScript libraries |
Cookie data for koulupsykologipalvelu.fi
Source: Actual web page - Timestamp: 2022-11-21 09:55Number of cookies: 0
| Cookie domain | Cookie values |
|---|
Screenshot for koulupsykologipalvelu.fi
Source: Actual web page - Timestamp: 2022-11-28 03:18
DNS records for koulupsykologipalvelu.fi
Source: DNS reponse - Timestamp: 2022-11-28 03:18
Whois record history for koulupsykologipalvelu.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
| Date | 2021-01-19 | 2021-08-04 | 2021-11-19 | 2022-08-04 | 2023-08-04 |
|---|---|---|---|---|---|
| Name | koulupsykologipalvelu.fi | koulupsykologipalvelu.fi | koulupsykologipalvelu.fi | koulupsykologipalvelu.fi | koulupsykologipalvelu.fi |
| State | Registered | Registered | Registered | Registered | Registered |
| Holder | Metodi OSK | Metodi OSK | Metodi OSK | Metodi OSK | Metodi OSK |
| Address | Köydenpunojankatu 2 B 8 | Köydenpunojankatu 2 B 8 | Köydenpunojankatu 2 B 8 | Köydenpunojankatu 2 B 8 | Köydenpunojankatu 2 B 8 |
| Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
| GrantDate | 2014-08-20T13:03:24 | 2014-08-20T13:03:24 | 2014-08-20T13:03:24 | 2014-08-20T13:03:24 | 2014-08-20T13:03:24 |
| Registrar | Suomen Hostingpalvelu Oy | Suomen Hostingpalvelu Oy | Planeetta Internet Oy | Planeetta Internet Oy | Planeetta Internet Oy |
| PostalArea | Turku | Turku | Turku | Turku | Turku |
| PostalCode | 20100 | 20100 | 20100 | 20100 | 20100 |
| NameServer1 | ns1.hostingpalvelu.fi | ns1.hostingpalvelu.fi | ns1.hostingpalvelu.fi | ns1.hostingpalvelu.fi | ns1.hostingpalvelu.fi |
| NameServer2 | ns2.hostingpalvelu.fi | ns2.hostingpalvelu.fi | ns2.hostingpalvelu.fi | ns2.hostingpalvelu.fi | ns2.hostingpalvelu.fi |
| PhoneNumber | |||||
| IsDNSSecInUse | no | no | no | no | no |
| OrganizationId | 1963639-1 | 1963639-1 | 1963639-1 | 1963639-1 | 1963639-1 |
| AssociationType | Company | Company | Company | Company | Company |
| LastValidityDate | 2021-08-20T10:28:41 | 2022-08-20T10:28:41 | 2022-08-20T10:28:41 | 2023-08-20T10:28:41 | 2024-08-20T10:28:41 |
| DepartmentOrContactPerson |
Server response for koulupsykologipalvelu.fi
Source: Web server reponse - Timestamp: 2022-11-28 03:18| Final URL | http://www.koulupsykologipalvelu.fi/ |
| HTTP Return Code | |
| IP Address | |
| Server Header | Server: Via: |
| Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on koulupsykologipalvelu.fi
Source: Web page analysis - Timestamp: 2022-11-28 03:18| Latest review | 2022-11-28 03:18 |
| Page language (from header) | (This is often false!) |
| Technologies |
Known subdomains for koulupsykologipalvelu.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700Number of subdomains found: 5
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 9
| Domain name | Final URL (when last tested) | Links | Last validity |
|---|---|---|---|
| aleksijalava.fi | http://www.aleksijalava.fi/ | 2024-09-14 | |
| hypnoterapia.fi | http://www.hypnoterapia.fi/ | 2024-08-20 | |
| kognitiivinenkayttaytymisterapia.fi | http://xn--kognitiivinenkyttytymisterapia-8scd.fi/ | 2025-01-28 | |
| kognitiivinenkäyttäytymisterapia.fi | http://www.xn--kognitiivinenkyttytymisterapia-8scd.fi/ | 2025-01-28 | |
| koulupsykologipalvelu.fi | http://www.koulupsykologipalvelu.fi/ | 2024-08-20 | |
| metodi.fi | No DNS records found | 2024-08-12 | |
| paripsykoterapiaa.fi | http://www.paripsykoterapiaa.fi/ | 2024-09-29 | |
| pariterapiaa.fi | http://www.pariterapiaa.fi/ | 2024-09-29 | |
| sateenkaarisohva.fi | http://www.sateenkaarisohva.fi/ | 2025-03-24 |