kognitiivinenterapia.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)| State | Registered |
| Holder | Vanajantie 4-6 A 3, Finland |
| Grant Date | 2013-04-08 |
| Last Validity Date | 2025-04-08 |
| Registrar | Euronic Oy 00510 Helsinki |
| Name Servers Please see DNS section for details | ns1.euronic.fi ns2.euronic.fi ns3.euronic.fi |
| Is The DNSSec in Use | No |
| IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2022-11-28 08:35WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
| IP source | IP address | ASN block data | IP Geolocation |
|---|---|---|---|
| User IP | 18.222.162.216 | This is not retrieved for now | Country: United States (US) State: Ohio (OH) City: Columbus Postal code: 43215 Latitude: 39.9653 Longitude: -83.0235 Network: 18.222.128.0/17 |
| Server IP | Autonomous System (AS) #: 201964 BGP prefix: 31.187.84.0/22 Country Code: FI Registry: ripencc Allocated: 2011-03-25 Info: EURONIC, FI | Country: Finland (FI) State: Uusimaa (18) City: Vantaa Postal code: 01620 Latitude: 60.2799 Longitude: 24.8537 Network: 31.187.84.0/22 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Word cloud for kognitiivinenterapia.fi
Source: Actual web page - Timestamp: 2022-11-28 08:35Notice: Miscellaneous words removed from the cloud to enhance the analytics
Web page details for kognitiivinenterapia.fi
Source: Actual web page - Timestamp: 2022-12-04 15:38| Header data & Meta tags | title etusivu robots index, follow referrer same-origin viewport width=device-width, initial-scale=1, maximum-scale=1 formatter Stacks v4.0.4 (4813) generator RapidWeaver not_found IE=edge,chrome=1text/html; charset=utf-8. website. WiseMind Psychotherapies & Consulting Oy. etusivu. http://www.wisemind.fi/index.html. |
| Open Graph (OG) meta tags | og:url http://www.wisemind.fi/index.html og:type website og:title etusivu og:site_name WiseMind Psychotherapies & Consulting Oy |
| Twitter cards | twitter:url http://www.wisemind.fi/index.html twitter:card summary twitter:site @teemuryhanen twitter:title etusivu twitter:creator @teemuryhanen |
| Cascading Style Sheets (CSS) (CSS) | files/stacks_page_page6.css rw_common/themes/exposition/consolidated.css http://fonts.googleapis.com/css?family=lato:400,600,700,800,900,400italic rw_common/plugins/stacks/stacks.css |
| Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
| JavaScript libraries | rw_common/themes/exposition/scripts/function.js rw_common/themes/exposition/scripts/banner/banner_4.js rw_common/themes/exposition/scripts/modernizr.min.js rw_common/assets/message.js rw_common/themes/exposition/scripts/slideshow/jquery.mobile.customized.min.js %pathto(scripts/bootstrap.js)% rw_common/themes/exposition/scripts/slideshow/camera.min.js %pathto(scripts/banner/slide_none.js)% %pathto(scripts/bootstrap.min.js)% rw_common/themes/exposition/javascript.js rw_common/themes/exposition/scripts/slideshow/camera.js rw_common/themes/exposition/scripts/slideshow/jquery.easing.1.3.js rw_common/themes/exposition/scripts/slideshow/jquery.min.js rw_common/themes/exposition/scripts/sidebar/remove.js |
Cookie data for kognitiivinenterapia.fi
Source: Actual web page - Timestamp: 2022-12-04 15:38Number of cookies: 5
| Cookie domain | Cookie values |
|---|---|
| wisemind.fi | Cookie name: __utma Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 60 bytes |
| wisemind.fi | Cookie name: __utmc Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 14 bytes |
| wisemind.fi | Cookie name: __utmz Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 75 bytes |
| wisemind.fi | Cookie name: __utmt Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 7 bytes |
| wisemind.fi | Cookie name: __utmb Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 30 bytes |
Screenshot for kognitiivinenterapia.fi
Source: Actual web page - Timestamp: 2022-11-28 08:35
DNS records for kognitiivinenterapia.fi
Source: DNS reponse - Timestamp: 2022-11-28 08:35| A | kognitiivinenterapia.fi 31.187.84.41 (Time to Live: 600) |
| MX | mail.kognitiivinenterapia.fi (Time to Live: 600) |
| NS | ns1.euronic.fi
|
| SOA | kognitiivinenterapia.fi ns1.euronic.fi (Time to Live: 600) hostmaster.euronic.fi |
Whois record history for kognitiivinenterapia.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
| Date | 2019-04-12 | 2020-03-13 | 2021-01-19 | 2021-03-13 | 2022-01-10 |
|---|---|---|---|---|---|
| Name | kognitiivinenterapia.fi | kognitiivinenterapia.fi | kognitiivinenterapia.fi | kognitiivinenterapia.fi | kognitiivinenterapia.fi |
| State | Registered | Registered | Registered | Registered | Registered |
| Holder | Teemu Ryhänen | Teemu Ryhänen | Teemu Ryhänen | Teemu Ryhänen | Teemu Ryhänen |
| Address | Vanajantie 4-6 A 3 | Vanajantie 4-6 A 3 | Vanajantie 4-6 A 3 | Vanajantie 4-6 A 3 | Vanajantie 4-6 A 3 |
| Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
| GrantDate | 2013-04-08T15:58:46 | 2013-04-08T15:58:46 | 2013-04-08T15:58:46 | 2013-04-08T15:58:46 | 2013-04-08T15:58:46 |
| Registrar | Euronic Oy | Euronic Oy | Euronic Oy | Euronic Oy | Euronic Oy |
| PostalArea | Helsinki | Helsinki | Helsinki | Helsinki | Helsinki |
| PostalCode | 00510 | 00510 | 00510 | 00510 | 00510 |
| NameServer1 | ns1.euronic.fi | ns1.euronic.fi | ns1.euronic.fi | ns1.euronic.fi | ns1.euronic.fi |
| NameServer2 | ns2.euronic.fi | ns2.euronic.fi | ns2.euronic.fi | ns2.euronic.fi | ns2.euronic.fi |
| NameServer3 | ns3.euronic.fi | ns3.euronic.fi | ns3.euronic.fi | ns3.euronic.fi | ns3.euronic.fi |
| PhoneNumber | 358445015075 | 358445015075 | |||
| IsDNSSecInUse | no | no | no | no | no |
| OrganizationId | 2210044-0 | 2210044-0 | 2210044-0 | 2210044-0 | 2210044-0 |
| AssociationType | Company | Company | Company | Company | Company |
| LastValidityDate | 2020-04-08T15:58:46 | 2021-04-08T15:58:46 | 2021-04-08T15:58:46 | 2022-04-08T15:58:46 | 2025-04-08T15:58:46 |
| DepartmentOrContactPerson |
Server response for kognitiivinenterapia.fi
Source: Web server reponse - Timestamp: 2022-11-28 08:35| Final URL | http://www.wisemind.fi/ |
| HTTP Return Code | HTTP/1.1 200 OK |
| IP Address | 31.187.84.41 Autonomous System (AS) #: 201964 BGP prefix: 31.187.84.0/22 Country Code: Finland (FI) Registry: ripencc Allocated: 2011-03-25 Info: EURONIC, FI |
| Server Header | Server: Nginx Via: |
| Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on kognitiivinenterapia.fi
Source: Web page analysis - Timestamp: 2022-11-28 08:35| Latest review | 2022-11-28 08:35 |
| Page language (from header) | (This is often false!) |
| Technologies |
Known subdomains for kognitiivinenterapia.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700No subdomains found
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 24
| Domain name | Final URL (when last tested) | Links | Last validity |
|---|---|---|---|
| abaterapia.fi | http://www.abaterapia.fi/ | 2024-06-09 | |
| ahdistuksenhallinta.fi | http://www.ahdistuksenhallinta.fi/ | 2025-07-23 | |
| altistus.fi | http://www.altistus.fi/ | 2025-01-05 | |
| altistushoito.fi | http://www.altistushoito.fi/ | 2025-07-22 | |
| altistustushoito.fi | http://www.altistustushoito.fi/ | 2025-01-05 | |
| behaviorlab.fi | http://behaviorlab.fi/ | 2026-05-06 | |
| dialektinenkayttaytymisterapia.fi | http://www.dialektinenkayttaytymisterapia.fi/ | 2025-04-03 | |
| dkt-koulutus.fi | http://www.dkt-koulutus.fi/ | 2024-06-09 | |
| dktkoulutus.fi | http://www.dktkoulutus.fi/ | 2024-06-09 | |
| dkt-terapeutit.fi | http://www.dkt-terapeutit.fi/ | 2024-06-09 | |
| dkt-yhdistys.fi | https://dkt-yhdistys.fi/ | 2025-10-16 | |
| hot-terapia.fi | http://www.hot-terapia.fi/ | 2024-06-09 | |
| hyvaksymisjaomistautumisterapia.fi | http://www.hyvaksymisjaomistautumisterapia.fi/ | 2025-07-23 | |
| kayttaytymisanalyysi.fi | http://www.kayttaytymisanalyysi.fi/ | 2025-12-28 | |
| kayttaytymisterapia.fi | http://www.kayttaytymisterapia.fi/ | 2026-04-05 | |
| ketjuanalyysi.fi | http://www.ketjuanalyysi.fi/ | 2024-06-09 | |
| kkt-koulutus.fi | http://www.kkt-koulutus.fi/ | 2024-06-09 | |
| kognitiivinenterapia.fi | http://www.wisemind.fi/ | 2025-04-08 | |
| psykoterapiatakuu.fi | http://www.psykoterapiatakuu.fi/ | 2024-06-09 | |
| respondentti.fi | http://www.respondentti.fi/ | 2024-06-09 | |
| taitoharjoittelu.fi | http://www.taitoharjoittelu.fi/ | 2025-05-30 | |
| terapiakoulutus.fi | http://www.terapiakoulutus.fi/ | 2024-11-05 | |
| viisaallamielella.fi | http://www.viisaallamielella.fi/ | 2025-08-15 | |
| wisemind.fi | http://www.wisemind.fi/ | 2025-10-06 |