kognitiivinenkäyttäytymisterapia.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)State | Registered |
Holder | Köydenpunojankatu 2 B 8, Finland |
Grant Date | 2015-01-28 |
Last Validity Date | 2025-01-28 |
Registrar | Planeetta Internet Oy 20100 Turku |
Name Servers Please see DNS section for details | ns1.hostingpalvelu.fi ns2.hostingpalvelu.fi |
Is The DNSSec in Use | No |
IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2022-11-28 16:32WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
IP source | IP address | ASN block data | IP Geolocation |
---|---|---|---|
User IP | 3.143.228.40 | This is not retrieved for now | Country: United States (US) State: Ohio (OH) City: Columbus Postal code: 43215 Latitude: 39.9653 Longitude: -83.0235 Network: 3.128.0.0/12 |
Server IP | Autonomous System (AS) #: 15830 BGP prefix: 31.217.192.0/23 Country Code: FI Registry: ripencc Allocated: 2011-08-17 Info: EQUINIX-CONNECT-EMEA, GB | Country: Finland (FI) State: Southern Savonia (04) City: Mikkeli Postal code: 50130 Latitude: 61.6782 Longitude: 27.2423 Network: 31.217.192.0/21 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Word cloud for kognitiivinenkäyttäytymisterapia.fi
Source: Actual web page - Timestamp: 2022-11-28 16:32Notice: Miscellaneous words removed from the cloud to enhance the analytics
Web page details for kognitiivinenkäyttäytymisterapia.fi
Source: Actual web page - Timestamp: 2022-12-04 16:12Header data & Meta tags | title 403 Forbidden |
Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
Cascading Style Sheets (CSS) (CSS) | |
Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
JavaScript libraries |
Cookie data for kognitiivinenkäyttäytymisterapia.fi
Source: Actual web page - Timestamp: 2022-12-04 16:12Number of cookies: 0
Cookie domain | Cookie values |
---|
Screenshot for kognitiivinenkäyttäytymisterapia.fi
Source: Actual web page - Timestamp: 2022-11-28 16:32
DNS records for kognitiivinenkäyttäytymisterapia.fi
Source: DNS reponse - Timestamp: 2022-11-28 16:32A | xn--kognitiivinenkyttytymisterapia-8scd.fi 31.217.192.164 (Time to Live: 359) |
MX | securemail1.hostingservice.fi (Time to Live: 3600) securemail2.hostingservice.fi (Time to Live: 3600) |
NS | ns2.hostingpalvelu.fi
|
SOA | xn--kognitiivinenkyttytymisterapia-8scd.fi ns1.hostingpalvelu.fi (Time to Live: 21600) info.hostingpalvelu.fi |
TXT | SPF records: v=spf1 ip4:31.217.192.61 +a +mx +ip4:31.217.192.164 +ip4:31.217.192.165 ~all |
Whois record history for kognitiivinenkäyttäytymisterapia.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
Date | 2021-01-19 | 2021-11-19 | 2022-01-07 | 2022-12-31 | 2024-01-07 |
---|---|---|---|---|---|
Name | kognitiivinenkäyttäytymisterapia.fi | kognitiivinenkäyttäytymisterapia.fi | kognitiivinenkäyttäytymisterapia.fi | kognitiivinenkäyttäytymisterapia.fi | kognitiivinenkäyttäytymisterapia.fi |
State | Registered | Registered | Registered | Registered | Registered |
Holder | Metodi OSK | Metodi OSK | Metodi OSK | Metodi OSK | Metodi OSK |
Address | Köydenpunojankatu 2 B 8 | Köydenpunojankatu 2 B 8 | Köydenpunojankatu 2 B 8 | Köydenpunojankatu 2 B 8 | Köydenpunojankatu 2 B 8 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2015-01-28T08:09:42 | 2015-01-28T08:09:42 | 2015-01-28T08:09:42 | 2015-01-28T08:09:42 | 2015-01-28T08:09:42 |
Registrar | Suomen Hostingpalvelu Oy | Planeetta Internet Oy | Planeetta Internet Oy | Planeetta Internet Oy | Planeetta Internet Oy |
PostalArea | Turku | Turku | Turku | Turku | Turku |
PostalCode | 20100 | 20100 | 20100 | 20100 | 20100 |
NameServer1 | ns1.hostingpalvelu.fi | ns1.hostingpalvelu.fi | ns1.hostingpalvelu.fi | ns1.hostingpalvelu.fi | ns1.hostingpalvelu.fi |
NameServer2 | ns2.hostingpalvelu.fi | ns2.hostingpalvelu.fi | ns2.hostingpalvelu.fi | ns2.hostingpalvelu.fi | ns2.hostingpalvelu.fi |
PhoneNumber | |||||
IsDNSSecInUse | no | no | no | no | no |
OrganizationId | 1963639-1 | 1963639-1 | 1963639-1 | 1963639-1 | 1963639-1 |
AssociationType | Company | Company | Company | Company | Company |
LastValidityDate | 2022-01-28T08:09:27 | 2022-01-28T08:09:27 | 2023-01-28T08:09:27 | 2024-01-28T08:09:27 | 2025-01-28T08:09:27 |
DepartmentOrContactPerson |
Server response for kognitiivinenkäyttäytymisterapia.fi
Source: Web server reponse - Timestamp: 2022-11-28 16:32Final URL | http://www.xn--kognitiivinenkyttytymisterapia-8scd.fi/ |
HTTP Return Code | HTTP/1.1 403 Forbidden |
IP Address | 31.217.192.164 Autonomous System (AS) #: 15830 BGP prefix: 31.217.192.0/23 Country Code: Finland (FI) Registry: ripencc Allocated: 2011-08-17 Info: EQUINIX-CONNECT-EMEA, GB |
Server Header | Server: Apache Via: |
Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on kognitiivinenkäyttäytymisterapia.fi
Source: Web page analysis - Timestamp: 2022-11-28 16:32Latest review | 2022-11-28 16:32 |
Page language (from header) | (This is often false!) |
Technologies |
Known subdomains for kognitiivinenkäyttäytymisterapia.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700No subdomains found
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 9
Domain name | Final URL (when last tested) | Links | Last validity |
---|---|---|---|
aleksijalava.fi | http://www.aleksijalava.fi/ | 2024-09-14 | |
hypnoterapia.fi | http://www.hypnoterapia.fi/ | 2024-08-20 | |
kognitiivinenkayttaytymisterapia.fi | http://xn--kognitiivinenkyttytymisterapia-8scd.fi/ | 2025-01-28 | |
kognitiivinenkäyttäytymisterapia.fi | http://www.xn--kognitiivinenkyttytymisterapia-8scd.fi/ | 2025-01-28 | |
koulupsykologipalvelu.fi | http://www.koulupsykologipalvelu.fi/ | 2024-08-20 | |
metodi.fi | No DNS records found | 2024-08-12 | |
paripsykoterapiaa.fi | http://www.paripsykoterapiaa.fi/ | 2024-09-29 | |
pariterapiaa.fi | http://www.pariterapiaa.fi/ | 2024-09-29 | |
sateenkaarisohva.fi | http://www.sateenkaarisohva.fi/ | 2025-03-24 |