
Server IP geolocation
Word cloud
Web page details & SOME
Cookie data
DNS records
Whois history
Server response
Used technologies
Holders domains


Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)
Holder Kievarinkatu 5, Finland
Grant Date2017-11-22
Last Validity Date2021-11-22
Registrarwww design
38840 Niinisalo
Name Servers
Please see DNS section for details
Is The DNSSec in Use No
IANA details for suffixTop Level Domain (TLD): FI
TLD manager: Finnish Transport and Communications Agency Traficom
Domain type: Country-code

Server IP location

Source: Actual web page - Timestamp: 2020-11-04 00:59
WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
IP sourceIP addressASN block dataIP Geolocation
User IP18.209.227.213This is not retrieved for nowCountry: United States   (US)
State: Virginia (VA)
City: Ashburn
Postal code: 20149
Latitude: 39.0481
Longitude: -77.4728
Server IPAutonomous System (AS) #: 16276
BGP prefix:
Country Code: FR
Registry: ripencc
Allocated: 2012-01-16
Info: OVH, FR
Country: France   (FR)
Postal code:
Latitude: 48.8582
Longitude: 2.3387

This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.

Word cloud for kankaanpaanmetsastysyhdistys.fi

Source: Actual web page - Timestamp: 2020-11-04 00:59
Notice: Miscellaneous words removed from the cloud to enhance the analytics

Web page details for kankaanpaanmetsastysyhdistys.fi

Source: Actual web page - Timestamp: 2020-12-02 02:37
Header data & Meta tagstitle Etusivu-Kankaanpään metsästysyhdistys ry
author WWW Design
robots index,follow
keywords metsästys,harrastus,luonto,yhdistys,kankaanpää,satakunta
viewport width=device-width, initial-scale=1, maximum-scale=1
not_found text/html; charset=utf-8fi-FI.
description Kankaanpään metsästysyhdistys ry Jäsenmäärämme lähenee 400 jäsentä. Metsästysalueita käytössä n. 16.000 hehtaaria.
Open Graph (OG) meta tagsUsing Open Graph tags is highly recommended for Search Engine Optimization (SEO)
Twitter cardsUsing Twitter tags is highly recommended for Search Engine Optimization (SEO)
Cascading Style Sheets (CSS) (CSS)https://fonts.googleapis.com/css?family=raleway:400,300,200,100,500,700,800,900,600
https://fonts.googleapis.com/css?family=open sans:300,400
Social Media (SOME) linksHaving Social Media content is highly recommended for Search Engine Optimization (SEO)
JavaScript libraries/media/jui/js/jquery.min.js?bda2af16dedc534569641a8abea75e89

Cookie data for kankaanpaanmetsastysyhdistys.fi

Source: Actual web page - Timestamp: 2020-12-02 02:37
Number of cookies: 1
Cookie domainCookie values
www.kankaanpaanmetsastysyhdistys.fiCookie name: c45606c2ad182d6419988ebe1e6273d9
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 58 bytes

Screenshot for kankaanpaanmetsastysyhdistys.fi

Source: Actual web page - Timestamp: 2020-11-04 00:59
Screenshot for kankaanpaanmetsastysyhdistys.fi

DNS records for kankaanpaanmetsastysyhdistys.fi

Source: DNS reponse - Timestamp: 2020-11-04 00:59
Akankaanpaanmetsastysyhdistys.fi  (Time to Live: 3591)
CAAkankaanpaanmetsastysyhdistys.fi    letsencrypt.org (Time to Live: 21599)
MXposti.nettipertti.fi (Time to Live: 3599)
SOAkankaanpaanmetsastysyhdistys.fi    ns1.nettipertti.fi (Time to Live: 21599)
TXTSPF records:

Whois record history for kankaanpaanmetsastysyhdistys.fi

Source: Finnish Transport and Communications Agency (Traficom)
Showing latest max 5 detected changes in the records. Changes are highlighted
Name kankaanpaanmetsastysyhdistys.fi kankaanpaanmetsastysyhdistys.fi kankaanpaanmetsastysyhdistys.fi kankaanpaanmetsastysyhdistys.fi kankaanpaanmetsastysyhdistys.fi
State Registered Registered Validity expired Registered Registered
Holder www design www design www design www design www design
Address Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5
Country   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)
GrantDate 2017-11-22T09:36:54.827 2017-11-22T09:36:54.827 2017-11-22T09:36:54.827 2017-11-22T09:36:54.827 2017-11-22T09:36:54.827
Registrar www design www design www design www design www design
PostalArea Niinisalo Niinisalo Niinisalo Niinisalo Niinisalo
PostalCode 38840 38840 38840 38840 38840
NameServer1 ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi
NameServer2 ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi
PhoneNumber +385456701770 +385456701770 +385456701770 +385456701770 +385456701770
IsDNSSecInUse no  no  no  no  no
OrganizationId 2503281-8 2503281-8 2503281-8 2503281-8 2503281-8
AssociationType Company Company Company Company Company
LastValidityDate 2018-11-22T09:36:54.827 2019-11-22T09:36:54.827 2019-11-22T09:36:54.827 2020-11-22T09:36:54.827 2021-11-22T09:36:54.827

Server response for kankaanpaanmetsastysyhdistys.fi

Source: Web server reponse - Timestamp: 2020-11-04 00:59
Final URLhttps://www.kankaanpaanmetsastysyhdistys.fi/
HTTP Return CodeHTTP/1.1 200 OK
IP Address 
Autonomous System (AS) #: 16276
BGP prefix:
Country Code:  France (FR)
Registry: ripencc
Allocated: 2012-01-16
Info: OVH, FR
Server HeaderServer: Apache/2.4.25 (Debian)
Certificate Issued By: Let's Encrypt
Issuer details: O=Let's Encrypt,   United States (US)
Issuer details: CN=Let's Encrypt Authority X3
Version: 2
Algorithm: RSA-SHA256
Issued On: 2020-10-27 00:00:00
Expires On: 2021-01-25 00:00:00
Certificate SubjectCountry (C):
Location (L):
Organization (O):
Common Name (CN): kankaanpaanmetsastysyhdistys.fi
Certificate Alternative Nameskankaanpaanmetsastysyhdistys.fi 

Used technologies on kankaanpaanmetsastysyhdistys.fi

Source: Web page analysis - Timestamp: 2020-11-04 00:59
Latest review2020-11-04 00:59
Page language (from header)en (This is often false!)
TechnologiesCloudFlare CloudFlare (CDN) (100% propable)
Google Tag Manager Google Tag Manager (Tag Managers) (100% propable)
HubSpot HubSpot (Marketing Automation) (100% propable)
Slick Slick (JavaScript Libraries) (100% propable)
YouTube YouTube (Video Players) (100% propable)
jQuery jQuery 1.7.1 (JavaScript Libraries) (100% propable)

Known subdomains for kankaanpaanmetsastysyhdistys.fi

Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700
Number of subdomains found: 1
SubdomainIP address

Web hosting providers

Source: All valid company websites with content (see below table)

Domains owned by same owner (current and past)

Source: Finnish Transport and Communications Agency (Traficom)
Number of domains: 97
Domain nameFinal URL
(when last tested)
LinksLast validity
ad-kpaa.fi https://www.kankaanpaanautohuolto.fi/  
Expired 2000-12-31
auto-sabo.fi http://www.auto-sabo.fi/  
autosabo.fi http://www.autosabo.fi/  
avainauto.fi https://www.avainauto.fi/index.php/fi/  
Expired 2018-08-14
Expired 2019-10-23
discgolfstore.fi https://www.frisbeegolf-forum.fi/  
Expired 2020-01-22
elinvoimainenkankaanpaa.fi http://www.elinvoimainenkankaanpaa.fi/  
Expired 2020-07-05
frisbeegolf-forum.fi https://www.frisbeegolf-forum.fi/  
frisbeegolfkauppa.fi https://www.frisbeegolf-forum.fi/  
futsalforum.fi http://www.futsalforum.fi/  
hevosenhetki.fi https://www.hevosenhetki.fi/  
Expired 2019-08-14
ilmavideot.fi http://www.ilmavideot.fi/  
Expired 2020-03-23
Expired 2020-05-02
jaanantaksi.fi https://www.jaanantaksi.fi/  
Expired 2018-12-10
kama1958.fi http://www.kama1958.fi/  
Expired 2020-02-04
kankaanpaanautohuolto.fi https://www.kankaanpaanautohuolto.fi/  
Expired 2019-11-02
kankaanpaanlasi.fi https://www.xn--kankaanpnlasi-ifba.fi/index.php  
kankaanpaanmetsastysyhdistys.fi https://www.kankaanpaanmetsastysyhdistys.fi/  
Expired 2019-03-17
Expired 2019-11-02
kankaanpäänlasi.fi https://www.xn--kankaanpnlasi-ifba.fi/  
kankaanpäänmetsastysyhdistys.fi https://kankaanpaanmetsastysyhdistys.fi/  
kankaanpäänmetsästysyhdistys.fi https://kankaanpaanmetsastysyhdistys.fi/  
kaupunkiseikkailu.fi https://design.yt/  
kiikanwallin.fi https://kiikanwallin.fi/  
Expired 2019-06-21
kuninkaanlahde.fi https://www.design.yt/  
kuntoutuslohtu.fi https://kuntoutuslohtu.fi/  
lauantaitorit.fi https://design.yt/  
lekatec.fi http://www.lekatec.fi/  
lelesb.fi http://www.lelesb.fi/  
lemppulegends.fi https://lemppulegends.fi/  
leppisfishing.fi https://www.leppisfishing.fi/  
levinhenkireika.fi https://levinhenkireika.fi/  
maila.fi No DNS records found  
meggala.fi http://www.meggala.fi/  
mm-kaupat.fi https://www.nettiauto.com/yritys/mm-kaupat  
monioljypoltin.fi http://www.monioljypoltin.fi/  
monioljypolttimenvaraosat.fi No DNS records found  
monioljypolttimet.fi https://www.monioljypolttimet.fi/  
mpvarikko.fi https://mpvarikko.fi/  
myyntivaunut.fi https://www.myyntivaunut.fi/  
neoen.fi http://www.neoen.fi/  
neoen-finland.fi http://www.neoen-finland.fi/  
Expired 2000-12-31
nettipertti.fi https://design.yt/  
northecoclean.fi https://northecoclean.fi/  
nuhvi.fi https://www.nuhvi.fi/index.php/fi/  
Expired 2019-08-24
Expired 2020-09-04
Expired 2019-06-26
oxdog.fi http://www.oxdog.fi/  
Expired 2000-12-31
Expired 2019-01-01
pelaajaboardcast.fi https://pelaajaboardcast.fi/  
pesapalloforum.fi No DNS records found  
pesisforum.fi https://www.supervuoro.com/  
pesisportaali.fi http://www.pesisportaali.fi/  
pienisuuriidea.fi https://pienisuuriidea.fi/  
pomarkunpyry.fi https://www.pomarkunpyry.fi/  
pompy.fi https://pomarkunpyry.fi/  
Expired 2018-03-07
Expired 2020-03-02
rakennuspalvelujarvinen.fi http://www.rakennuspalvelujarvinen.fi/  
reseptikilpailu.fi https://www.reseptikilpailu.fi/  
Expired 2000-12-31
route55.fi http://www.route55.fi/  
salibandyforum.fi http://www.salibandyforum.fi/  
salonsaxin.fi https://salonsaxin.fi/  
sarmeen.fi http://www.sarmeen.fi/  
satakunnanurheiluklinikka.fi https://satakunnanurheiluklinikka.fi/  
siilibarterrace.fi http://www.siilibarterrace.fi/  
sillanmaki.fi https://www.sillanmaki.fi/  
snowracers.fi http://www.snowracers.fi/  
so11.fi https://design.yt/  
suomenravintolalaite.fi https://suomenravintolalaite.fi/  
sähkösun.fi https://xn--shksun-bua0m.fi/  
tacogarcia.fi https://www.tacogarcia.fi/  
taksileponiemi.fi https://taksileponiemi.fi/  
Expired 2019-02-26
tilataksipori.fi https://klsalminen.fi/  
tomoottajat.fi http://tomoottajat.fi/  
Expired 2000-12-31
varastoon.fi https://varastoon.fi/  
verkkokauppakorpela.fi http://www.verkkokauppakorpela.fi/  
vientiautot.fi https://www.vientiautot.fi/  
vikapihalle.fi https://www.vikapihalle.fi/  
yli-rami.fi http://www.yli-rami.fi/  