
Server IP geolocation
Word cloud
Web page details & SOME
Cookie data
DNS records
Whois history
Server response
Used technologies
Holders domains


Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)
Holder Kievarinkatu 5, Finland

Grant Date2017-11-22
Last Validity Date2022-11-22
Registrarwww design
38840 Niinisalo
Name Servers
Please see DNS section for details
Is The DNSSec in Use No
IANA details for suffixTop Level Domain (TLD): FI
TLD manager: Finnish Transport and Communications Agency Traficom
Domain type: Country-code

Server IP location

Source: Actual web page - Timestamp: 2021-10-01 20:21
WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
IP sourceIP addressASN block dataIP Geolocation
User IP54.144.55.253This is not retrieved for nowCountry: United States   (US)
State: Virginia (VA)
City: Ashburn
Postal code: 20149
Latitude: 39.0481
Longitude: -77.4728
Server IPAutonomous System (AS) #: 24940
BGP prefix:
Country Code: DE
Registry: ripencc
Allocated: 2009-02-24
Country: Germany   (DE)
Postal code:
Latitude: 51.2993
Longitude: 9.491

This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.

Word cloud for kankaanpäänmetsastysyhdistys.fi

Source: Actual web page - Timestamp: 2021-10-01 20:21
Notice: Miscellaneous words removed from the cloud to enhance the analytics

Web page details for kankaanpäänmetsastysyhdistys.fi

Source: Actual web page - Timestamp: 2021-11-25 02:05
Header data & Meta tagstitle Etusivu
author WWW Design
viewport width=device-width, initial-scale=1, maximum-scale=1
not_found text/html; charset=utf-8fi-FI.
Open Graph (OG) meta tagsUsing Open Graph tags is highly recommended for Search Engine Optimization (SEO)
Twitter cardsUsing Twitter tags is highly recommended for Search Engine Optimization (SEO)
Cascading Style Sheets (CSS) (CSS)/media/com_icagenda/css/tiptip.css
https://fonts.googleapis.com/css?family=open sans:300,400
Social Media (SOME) linksHaving Social Media content is highly recommended for Search Engine Optimization (SEO)
JavaScript libraries/media/jui/js/jquery.min.js?5979b579dbb84994b22728e2aefbf1d1

Cookie data for kankaanpäänmetsastysyhdistys.fi

Source: Actual web page - Timestamp: 2021-11-25 02:05
Number of cookies: 1
Cookie domainCookie values
kankaanpaanmetsastysyhdistys.fiCookie name: c45606c2ad182d6419988ebe1e6273d9
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 58 bytes

Screenshot for kankaanpäänmetsastysyhdistys.fi

Source: Actual web page - Timestamp: 2021-10-01 20:21
Screenshot for kankaanpäänmetsastysyhdistys.fi

DNS records for kankaanpäänmetsastysyhdistys.fi

Source: DNS reponse - Timestamp: 2021-10-01 20:21
Axn--kankaanpnmetsastysyhdistys-nhca.fi  (Time to Live: 3590)
MXposti.nettipertti.fi (Time to Live: 3600)
SOAxn--kankaanpnmetsastysyhdistys-nhca.fi    ns1.nettipertti.fi (Time to Live: 21600)
TXTSPF records:

Whois record history for kankaanpäänmetsastysyhdistys.fi

Source: Finnish Transport and Communications Agency (Traficom)
Showing latest max 5 detected changes in the records. Changes are highlighted
Name kankaanpäänmetsastysyhdistys.fi kankaanpäänmetsastysyhdistys.fi kankaanpäänmetsastysyhdistys.fi kankaanpäänmetsastysyhdistys.fi kankaanpäänmetsastysyhdistys.fi
State Validity expired Registered Registered Registered Registered
Holder www design www design www design www design www design
Address Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5
Country   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)
GrantDate 2017-11-22T09:40:07.687 2017-11-22T09:40:07.687 2017-11-22T09:40:07.687 2017-11-22T09:40:07.687 2017-11-22T09:40:07.687
Registrar www design www design www design www design www design
PostalArea Niinisalo Niinisalo Niinisalo Niinisalo Niinisalo
PostalCode 38840 38840 38840 38840 38840
NameServer1 ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi
NameServer2 ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi
PhoneNumber +385456701770 +385456701770 +385456701770  
IsDNSSecInUse no  no  no  no  no
OrganizationId 2503281-8 2503281-8 2503281-8 2503281-8 2503281-8
AssociationType Company Company Company Company Company
LastValidityDate 2019-11-22T09:40:07.687 2020-11-22T09:40:07.687 2021-11-22T09:40:07.687 2021-11-22T09:40:07.687 2022-11-22T09:40:07.687

Server response for kankaanpäänmetsastysyhdistys.fi

Source: Web server reponse - Timestamp: 2021-10-01 20:21
Final URLhttps://kankaanpaanmetsastysyhdistys.fi/
HTTP Return CodeHTTP/1.1 200 OK
IP Address 
Autonomous System (AS) #: 24940
BGP prefix:
Country Code:  Germany (DE)
Registry: ripencc
Allocated: 2009-02-24
Server HeaderServer: Apache
Certificate Issued By: Let's Encrypt
Issuer details: O=Let's Encrypt,   United States (US)
Issuer details: CN=R3
Version: 2
Algorithm: RSA-SHA256
Issued On: 2021-08-23 00:00:00
Expires On: 2021-11-21 00:00:00
Certificate SubjectCountry (C):
Location (L):
Organization (O):
Common Name (CN): kankaanpaanmetsastysyhdistys.fi
Certificate Alternative Nameskankaanpaanmetsastysyhdistys.fi 

Used technologies on kankaanpäänmetsastysyhdistys.fi

Source: Web page analysis - Timestamp: 2021-10-01 20:21
Latest review2021-10-01 20:21
Page language (from header)en-US (This is often false!)
TechnologiesCloudFlare CloudFlare (CDN) (100% propable)
Google Font API Google Font API (Font Scripts) (100% propable)
HubSpot HubSpot (Marketing Automation) (100% propable)
WordPress WordPress (CMSBlogs) (100% propable)
Yoast SEO Yoast SEO 17.2 (SEO) (100% propable)
jQuery jQuery 3.6.0 (JavaScript Libraries) (100% propable)
jQuery Migrate jQuery Migrate 3.3.2 (JavaScript Libraries) (100% propable)

Known subdomains for kankaanpäänmetsastysyhdistys.fi

Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700
No subdomains found

Web hosting providers

Source: All valid company websites with content (see below table)

Domains owned by same owner (current and past)

Source: Finnish Transport and Communications Agency (Traficom)
Number of domains: 135
Domain nameFinal URL
(when last tested)
LinksLast validity
4321.fi http://www.4321.fi/  
ad-kpaa.fi https://kankaanpaanautohuolto.fi/  
Expired 2000-12-31
auto-sabo.fi http://www.auto-sabo.fi/  
autosabo.fi http://www.autosabo.fi/  
avainauto.fi https://www.avainauto.fi/index.php/fi/  
Expired 2018-08-14
Expired 2019-10-23
discgolfstore.fi https://www.frisbeegolf-forum.fi/  
Expired 2020-01-22
elinvoimainenkankaanpaa.fi http://www.elinvoimainenkankaanpaa.fi/  
Expired 2020-07-05
fixus-kankaanpaa.fi https://kankaanpaanautohuolto.fi/  
frisbeegolf-forum.fi https://www.frisbeegolf-forum.fi/  
frisbeegolfkauppa.fi https://www.frisbeegolf-forum.fi/  
futsalforum.fi https://www.futsalforum.fi/  
geopark-suomi.fi https://geopark-suomi.fi/  
hatax.fi https://hatax.fi/  
Expired 2021-05-25
Expired 2019-08-14
ilmalampopumppukauppa.fi http://www.ilmalampopumppukauppa.fi/  
ilmavideot.fi http://www.ilmavideot.fi/  
Expired 2020-03-23
Expired 2020-05-02
jaanantaksi.fi https://www.jaanantaksi.fi/  
Expired 2018-12-10
kalastustukku.fi http://www.kalastustukku.fi/  
kama1958.fi http://www.kama1958.fi/  
Expired 2020-02-04
kankaanpaanautohuolto.fi https://kankaanpaanautohuolto.fi/  
Expired 2019-11-02
Expired 2019-11-02
kankaanpaanlasi.fi https://xn--kankaanpnlasi-ifba.fi/  
kankaanpäänlasi.fi https://xn--kankaanpnlasi-ifba.fi/  
kankaanpaanmetsastysyhdistys.fi https://www.kankaanpaanmetsastysyhdistys.fi/  
kankaanpäänmetsastysyhdistys.fi https://kankaanpaanmetsastysyhdistys.fi/  
kankaanpäänmetsästysyhdistys.fi https://kankaanpaanmetsastysyhdistys.fi/  
kankaanpaanomaishoitajat.fi http://www.kankaanpaanomaishoitajat.fi/  
katalysaattorit.fi http://www.katalysaattorit.fi/  
katsastusasemat.fi http://www.katsastusasemat.fi/  
kaupunkiseikkailu.fi https://design.yt/  
kesyry.fi https://kesyry.fi/  
kiikanwallin.fi https://kiikanwallin.fi/  
Expired 2019-06-21
kpaalasi.fi https://xn--kankaanpnlasi-ifba.fi/  
kuninkaanlahde.fi https://www.design.yt/  
kuntoutuslohtu.fi https://kuntoutuslohtu.fi/  
laboratoriotarvike.fi No DNS records found  
lammoneriste.fi http://www.lammoneriste.fi/  
lämmöneriste.fi http://www.xn--lmmneriste-q5a2t.fi/  
lämpöpumppukauppa.fi https://wattila.fi/  
lampopumppukeskus.fi http://www.lampopumppukeskus.fi/  
lauantaitorit.fi https://design.yt/  
Expired 2021-07-30
lelesb.fi http://www.lelesb.fi/  
lemppulegends.fi https://lemppulegends.fi/  
leppisfishing.fi https://leppisfishing.fi/  
levinhenkireika.fi https://levinhenkireika.fi/  
lihanmestarit.fi http://www.lihanmestarit.fi/  
löytökorpi.fi http://www.xn--lytkorpi-n4ac.fi/  
maila.fi http://www.maila.fi/  
meggala.fi http://www.meggala.fi/  
metsastyskeskustelu.fi https://www.metsastyskeskustelu.fi/  
mm-kaupat.fi https://www.nettiauto.com/yritys/343149  
monioljypoltin.fi https://xn--moniljypolttimet-pwb.fi/  
monioljypolttimenvaraosat.fi http://www.monioljypolttimenvaraosat.fi/  
monioljypolttimet.fi https://www.monioljypolttimet.fi/  
Expired 2021-05-03
myyntivaunut.fi https://www.myyntivaunut.fi/  
neoen.fi http://www.neoen.fi/  
neoen-finland.fi http://www.neoen-finland.fi/  
Expired 2000-12-31
nettipalvelin.fi http://www.nettipalvelin.fi/  
nettipertti.fi https://design.yt/  
nonstopparturi.fi http://www.nonstopparturi.fi/  
Expired 2021-09-29
nuhvi.fi https://www.nuhvi.fi/index.php/fi/  
Expired 2019-08-24
Expired 2020-09-04
öljysäiliö.fi http://www.xn--ljysili-8wa1ni.fi/  
Expired 2019-06-26
oulunautohuolto.fi http://www.oulunautohuolto.fi/  
oxdog.fi No DNS records found  
Expired 2000-12-31
Expired 2019-01-01
pelaajaboardcast.fi https://pelaajaboardcast.fi/  
pesapalloforum.fi http://www.pesapalloforum.fi/  
pesisforum.fi https://www.supervuoro.com/  
pesisportaali.fi http://www.pesisportaali.fi/  
pienisuuriidea.fi https://pienisuuriidea.fi/  
pirkanmaanpohjarakennus.fi No DNS records found  
pomarkunpyry.fi https://design.yt/  
pompy.fi No DNS records found  
Expired 2018-03-07
putkiasennusta.fi http://www.putkiasennusta.fi/  
rajalamotorsport.fi https://www.rajalamotorsport.fi/  
Expired 2020-03-02
rakennuspalvelujarvinen.fi https://www.rakennuspalvelujarvinen.fi/  
raskaskonehuolto.fi http://www.raskaskonehuolto.fi/  
raskaskonekorjaus.fi http://www.raskaskonekorjaus.fi/  
reseptikilpailu.fi No DNS records found  
retkilemi.fi https://retkilemi.fi/  
Expired 2000-12-31
Expired 2021-10-26
sähkösun.fi https://xn--shksun-bua0m.fi/  
salibandyforum.fi http://www.salibandyforum.fi/  
salonsaxin.fi http://www.salonsaxin.fi/cgi-sys/suspendedpage.cgi  
sarmeen.fi http://www.sarmeen.fi/  
satakunnantaksi.fi http://www.satakunnantaksi.fi/  
Expired 2021-09-13
sillanmaki.fi https://www.sillanmaki.fi/  
snowracers.fi http://www.snowracers.fi/  
so11.fi https://design.yt/  
suomenravintolalaite.fi https://suomenravintolalaite.fi/  
suunterveys.fi http://www.suunterveys.fi/  
tacogarcia.fi No DNS records found  
taksifoorumi.fi http://www.taksifoorumi.fi/  
taksileponiemi.fi https://taksileponiemi.fi/  
tapahtumaviikko.fi http://www.tapahtumaviikko.fi/  
teollisuusimuri.fi http://www.teollisuusimuri.fi/  
tieturvakurssi.fi http://www.tieturvakurssi.fi/  
Expired 2019-02-26
tilataksipori.fi https://tilataksipori.fi/  
tomoottajat.fi https://tomoottajat.fi/  
trukkikortti.fi http://www.trukkikortti.fi/  
Expired 2000-12-31
varastoon.fi https://varastoon.fi/  
verkkokauppakorpela.fi https://verkkokauppakorpela.fi/  
vientiautot.fi https://www.vientiautot.fi/  
Expired 2021-10-11
volvo-ohjelmointi.fi No DNS records found  
volvoohjelmointi.fi No DNS records found  
wwwdesign.fi http://www.wwwdesign.fi/  
yli-rami.fi http://www.yli-rami.fi/  
yritysesittelyvideo.fi http://www.yritysesittelyvideo.fi/  