kankaanpäänmetsastysyhdistys.fi  


Details
 
Server IP geolocation
 
Word cloud
 
Web page details & SOME
 
Cookie data
 
Screenshot
 
DNS records
 
Whois history
 
Server response
 
Used technologies
 
Subdomains
 
Hosting
 
Holders domains
 


Details

Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)
StateRegistered
Holder Kievarinkatu 5, Finland
+385456701770
Grant Date2017-11-22
Last Validity Date2021-11-22
Registrarwww design
38840 Niinisalo
Name Servers
Please see DNS section for details
ns1.nettipertti.fi
ns2.nettipertti.fi
Is The DNSSec in Use No
IANA details for suffixTop Level Domain (TLD): FI
TLD manager: Finnish Transport and Communications Agency Traficom
Domain type: Country-code



Server IP location

Source: Actual web page - Timestamp: 2020-11-03 18:57
WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
IP sourceIP addressASN block dataIP Geolocation
User IP18.209.227.213This is not retrieved for nowCountry: United States   (US)
State: Virginia (VA)
City: Ashburn
Postal code: 20149
Latitude: 39.0481
Longitude: -77.4728
Network: 18.209.224.0/19
Server IPAutonomous System (AS) #: 16276
BGP prefix: 37.59.0.0/16
Country Code: FR
Registry: ripencc
Allocated: 2012-01-16
Info: OVH, FR
Country: France   (FR)
City:
Postal code:
Latitude: 48.8582
Longitude: 2.3387
Network: 37.59.236.0/23

This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.



Word cloud for kankaanpäänmetsastysyhdistys.fi

Source: Actual web page - Timestamp: 2020-11-03 18:57
Notice: Miscellaneous words removed from the cloud to enhance the analytics



Web page details for kankaanpäänmetsastysyhdistys.fi

Source: Actual web page - Timestamp: 2020-12-02 02:13
Header data & Meta tagstitle Etusivu-Kankaanpään metsästysyhdistys ry
author WWW Design
robots index,follow
keywords metsästys,harrastus,luonto,yhdistys,kankaanpää,satakunta
viewport width=device-width, initial-scale=1, maximum-scale=1
not_found text/html; charset=utf-8fi-FI.
description Kankaanpään metsästysyhdistys ry Jäsenmäärämme lähenee 400 jäsentä. Metsästysalueita käytössä n. 16.000 hehtaaria.
Open Graph (OG) meta tagsUsing Open Graph tags is highly recommended for Search Engine Optimization (SEO)
Twitter cardsUsing Twitter tags is highly recommended for Search Engine Optimization (SEO)
Cascading Style Sheets (CSS) (CSS)https://fonts.googleapis.com/css?family=raleway:400,300,200,100,500,700,800,900,600
/templates/joomlage0107-carran/css/bootstrap.css
/modules/mod_djimageslider/themes/default/css/djimageslider.css
/components/com_icagenda/themes/packs/default/css/default_module.css
https://fonts.googleapis.com/css?family=open sans:300,400
/templates/system/css/system.css
https://fonts.googleapis.com/css?family=lato:400,300,100,700,900
/templates/joomlage0107-carran/css/nexus.css
https://fonts.googleapis.com/css?family=raleway:300,400
/templates/joomlage0107-carran/css/typo.css
/modules/mod_joomlageimagehover/assets/css/admin.css
/modules/mod_joomlageimagehover/assets/css/module.css
/modules/mod_joomlageimagehover/assets/plugins/fontawesome/css/font-awesome.css
/templates/joomlage0107-carran/css/font-awesome.css
/templates/joomlage0107-carran/css/reset.css
/media/com_icagenda/icicons/style.css
/templates/joomlage0107-carran/css/module-suffix-classes.css
/templates/joomlage0107-carran/css/animate.css
/templates/joomlage0107-carran/css/responsive.css
/media/com_icagenda/css/tiptip.css
Social Media (SOME) linksHaving Social Media content is highly recommended for Search Engine Optimization (SEO)
JavaScript libraries/media/jui/js/jquery.min.js?bda2af16dedc534569641a8abea75e89
/media/jui/js/jquery-migrate.min.js?bda2af16dedc534569641a8abea75e89
/media/jui/js/bootstrap.min.js?bda2af16dedc534569641a8abea75e89
/modules/mod_iccalendar/js/jquery.highlighttoday.min.js
/media/system/js/core.js?bda2af16dedc534569641a8abea75e89
/media/system/js/mootools-core.js?bda2af16dedc534569641a8abea75e89
/media/com_icagenda/js/jquery.tiptip.js
/modules/mod_djimageslider/assets/js/slider.js?v=4.0.0
/templates/joomlage0107-carran/js/modernizr.js
/media/system/js/mootools-more.js?bda2af16dedc534569641a8abea75e89
/media/jui/js/jquery-noconflict.js?bda2af16dedc534569641a8abea75e89
/templates/joomlage0107-carran/js/responsive-nav.js
/templates/joomlage0107-carran/js/jquery.visible.js
/templates/joomlage0107-carran/js/jquery.sticky.js
/media/system/js/caption.js?bda2af16dedc534569641a8abea75e89
/templates/joomlage0107-carran/js/jquery.stellar.js
/media/djextensions/jquery-easing/jquery.easing.min.js



Cookie data for kankaanpäänmetsastysyhdistys.fi

Source: Actual web page - Timestamp: 2020-12-02 02:13
Number of cookies: 1
Cookie domainCookie values
kankaanpaanmetsastysyhdistys.fiCookie name: c45606c2ad182d6419988ebe1e6273d9
Cookie expiry/purpose: Session cookie (removed after session ends)
Cookie size: 58 bytes



Screenshot for kankaanpäänmetsastysyhdistys.fi

Source: Actual web page - Timestamp: 2020-11-03 18:57
Screenshot for kankaanpäänmetsastysyhdistys.fi



DNS records for kankaanpäänmetsastysyhdistys.fi

Source: DNS reponse - Timestamp: 2020-11-03 18:57
Axn--kankaanpnmetsastysyhdistys-nhca.fi    37.59.237.193  (Time to Live: 3585)
MXposti.nettipertti.fi (Time to Live: 3599)
NSns1.nettipertti.fins2.nettipertti.fi
SOAxn--kankaanpnmetsastysyhdistys-nhca.fi    ns1.nettipertti.fi (Time to Live: 21599)
hostmaster.nettipertti.fi
TXTSPF records:
v=spf1
mx
~all



Whois record history for kankaanpäänmetsastysyhdistys.fi

Source: Finnish Transport and Communications Agency (Traficom)
Showing latest max 5 detected changes in the records. Changes are highlighted
Date2018-05-052019-04-122019-11-252019-11-282020-11-25
Name kankaanpäänmetsastysyhdistys.fi kankaanpäänmetsastysyhdistys.fi kankaanpäänmetsastysyhdistys.fi kankaanpäänmetsastysyhdistys.fi kankaanpäänmetsastysyhdistys.fi
State Registered Registered Validity expired Registered Registered
Holder www design www design www design www design www design
Address Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5
Country   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)
GrantDate 2017-11-22T09:40:07.687 2017-11-22T09:40:07.687 2017-11-22T09:40:07.687 2017-11-22T09:40:07.687 2017-11-22T09:40:07.687
Registrar www design www design www design www design www design
PostalArea Niinisalo Niinisalo Niinisalo Niinisalo Niinisalo
PostalCode 38840 38840 38840 38840 38840
NameServer1 ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi
NameServer2 ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi
PhoneNumber +385456701770 +385456701770 +385456701770 +385456701770 +385456701770
IsDNSSecInUse no  no  no  no  no
OrganizationId 2503281-8 2503281-8 2503281-8 2503281-8 2503281-8
AssociationType Company Company Company Company Company
LastValidityDate 2018-11-22T09:40:07.687 2019-11-22T09:40:07.687 2019-11-22T09:40:07.687 2020-11-22T09:40:07.687 2021-11-22T09:40:07.687
DepartmentOrContactPerson     



Server response for kankaanpäänmetsastysyhdistys.fi

Source: Web server reponse - Timestamp: 2020-11-03 18:57
Final URLhttps://kankaanpaanmetsastysyhdistys.fi/
HTTP Return CodeHTTP/1.1 200 OK
IP Address
37.59.237.193 
Autonomous System (AS) #: 16276
BGP prefix: 37.59.0.0/16
Country Code:  France (FR)
Registry: ripencc
Allocated: 2012-01-16
Info: OVH, FR
Server HeaderServer: Apache/2.4.25 (Debian)
Via:
Certificate Issued By: Let's Encrypt
Issuer details: O=Let's Encrypt,   United States (US)
Issuer details: CN=Let's Encrypt Authority X3
Version: 2
Algorithm: RSA-SHA256
Issued On: 2020-10-27 00:00:00
Expires On: 2021-01-25 00:00:00
Certificate SubjectCountry (C):
Location (L):
Organization (O):
Common Name (CN): kankaanpaanmetsastysyhdistys.fi
Certificate Alternative Nameskankaanpaanmetsastysyhdistys.fi 
www.kankaanpaanmetsastysyhdistys.fi 
www.xn--kankaanpnmetsastysyhdistys-nhca.fi 
www.xn--kankaanpnmetsstysyhdistys-secaf.fi 
xn--kankaanpnmetsastysyhdistys-nhca.fi 
xn--kankaanpnmetsstysyhdistys-secaf.fi 



Used technologies on kankaanpäänmetsastysyhdistys.fi

Source: Web page analysis - Timestamp: 2020-11-03 18:57
Latest review2020-11-03 18:57
Page language (from header)en (This is often false!)
TechnologiesCloudFlare CloudFlare (CDN) (100% propable)
Google Tag Manager Google Tag Manager (Tag Managers) (100% propable)
HubSpot HubSpot (Marketing Automation) (100% propable)
Slick Slick (JavaScript Libraries) (100% propable)
YouTube YouTube (Video Players) (100% propable)
jQuery jQuery 1.7.1 (JavaScript Libraries) (100% propable)



Known subdomains for kankaanpäänmetsastysyhdistys.fi

Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700
No subdomains found



Web hosting providers

Source: All valid company websites with content (see below table)



Domains owned by same owner (current and past)

Source: Finnish Transport and Communications Agency (Traficom)
Number of domains: 97
Domain nameFinal URL
(when last tested)
LinksLast validity
ad-kpaa.fi https://www.kankaanpaanautohuolto.fi/  
Details
Screenshot
2021-04-20
ahofarm.fi  
Details
Expired 2000-12-31
auto-sabo.fi http://www.auto-sabo.fi/  
Details
Screenshot
2021-08-06
autosabo.fi http://www.autosabo.fi/  
Details
Screenshot
2021-08-06
avainauto.fi https://www.avainauto.fi/index.php/fi/  
Details
Screenshot
2021-07-31
benzboy.fi  
Details
Expired 2018-08-14
design-suomi.fi  
Details
Screenshot
Expired 2019-10-23
discgolfstore.fi https://www.frisbeegolf-forum.fi/  
Details
Screenshot
2021-02-08
driveit.fi  
Details
Screenshot
Expired 2020-01-22
elinvoimainenkankaanpaa.fi http://www.elinvoimainenkankaanpaa.fi/  
Details
Screenshot
2021-09-06
eurogarment.fi  
Details
Screenshot
Expired 2020-07-05
frisbeegolf-forum.fi https://www.frisbeegolf-forum.fi/  
Details
Screenshot
2021-01-01
frisbeegolfkauppa.fi https://www.frisbeegolf-forum.fi/  
Details
Screenshot
2021-02-08
futsalforum.fi http://www.futsalforum.fi/  
Details
Screenshot
2020-12-13
hevosenhetki.fi https://www.hevosenhetki.fi/  
Details
Screenshot
2021-05-25
hotellitoholampi.fi  
Details
Screenshot
Expired 2019-08-14
ilmavideot.fi http://www.ilmavideot.fi/  
Details
Screenshot
2021-08-26
itpaja.fi  
Details
Screenshot
Expired 2020-03-23
itpalvelukallionkieli.fi  
Details
Screenshot
Expired 2020-05-02
jaanantaksi.fi https://www.jaanantaksi.fi/  
Details
Screenshot
2020-12-13
jk-inks.fi  
Details
Expired 2018-12-10
kama1958.fi http://www.kama1958.fi/  
Details
Screenshot
2021-06-14
kangasfysio.fi  
Details
Screenshot
Expired 2020-02-04
kankaanpaanautohuolto.fi https://www.kankaanpaanautohuolto.fi/  
Details
Screenshot
2021-03-10
kankaanpaanjoulu.fi  
Details
Screenshot
Expired 2019-11-02
kankaanpaanlasi.fi https://www.xn--kankaanpnlasi-ifba.fi/index.php  
Details
Screenshot
2020-12-13
kankaanpaanmetsastysyhdistys.fi https://www.kankaanpaanmetsastysyhdistys.fi/  
Details
Screenshot
2021-11-22
kankaanpaanomaishoitajat.fi  
Details
Expired 2019-03-17
kankaanpäänjoulu.fi  
Details
Screenshot
Expired 2019-11-02
kankaanpäänlasi.fi https://www.xn--kankaanpnlasi-ifba.fi/  
Details
Screenshot
2021-08-26
kankaanpäänmetsastysyhdistys.fi https://kankaanpaanmetsastysyhdistys.fi/  
Details
Screenshot
2021-11-22
kankaanpäänmetsästysyhdistys.fi https://kankaanpaanmetsastysyhdistys.fi/  
Details
Screenshot
2021-02-26
kaupunkiseikkailu.fi https://design.yt/  
Details
Screenshot
2021-05-10
kiikanwallin.fi https://kiikanwallin.fi/  
Details
Screenshot
2021-07-30
kotiyleiso.fi  
Details
Screenshot
Expired 2019-06-21
kuninkaanlahde.fi https://www.design.yt/  
Details
Screenshot
2021-03-19
kuntoutuslohtu.fi https://kuntoutuslohtu.fi/  
Details
Screenshot
2021-07-05
lauantaitorit.fi https://design.yt/  
Details
Screenshot
2021-04-05
lekatec.fi http://www.lekatec.fi/  
Details
Screenshot
2021-07-30
lelesb.fi http://www.lelesb.fi/  
Details
Screenshot
2021-08-11
lemppulegends.fi https://lemppulegends.fi/  
Details
Screenshot
2021-08-25
leppisfishing.fi https://www.leppisfishing.fi/  
Details
Screenshot
2021-03-26
levinhenkireika.fi https://levinhenkireika.fi/  
Details
Screenshot
2021-05-02
maila.fi No DNS records found  
Details
2021-02-22
meggala.fi http://www.meggala.fi/  
Details
Screenshot
2020-12-27
mm-kaupat.fi https://www.nettiauto.com/yritys/mm-kaupat  
Details
Screenshot
2021-06-06
monioljypoltin.fi http://www.monioljypoltin.fi/  
Details
Screenshot
2021-05-21
monioljypolttimenvaraosat.fi No DNS records found  
Details
2021-11-16
monioljypolttimet.fi https://www.monioljypolttimet.fi/  
Details
Screenshot
2021-08-26
mpvarikko.fi https://mpvarikko.fi/  
Details
Screenshot
2021-05-03
myyntivaunut.fi https://www.myyntivaunut.fi/  
Details
Screenshot
2021-05-30
neoen.fi http://www.neoen.fi/  
Details
Screenshot
2021-09-29
neoen-finland.fi http://www.neoen-finland.fi/  
Details
Screenshot
2021-09-29
nesvuokrapelit.fi  
Details
Screenshot
Expired 2000-12-31
nettipertti.fi https://design.yt/  
Details
Screenshot
2022-12-02
northecoclean.fi https://northecoclean.fi/  
Details
Screenshot
2021-09-29
nuhvi.fi https://www.nuhvi.fi/index.php/fi/  
Details
Screenshot
2021-02-25
ohjelmasiili.fi  
Details
Screenshot
Expired 2019-08-24
ohjelmatoimistosiili.fi  
Details
Screenshot
Expired 2020-09-04
olkimix.fi  
Details
Screenshot
Expired 2019-06-26
oxdog.fi http://www.oxdog.fi/  
Details
Screenshot
2021-11-20
pauliinap.fi  
Details
Screenshot
Expired 2000-12-31
pe-53.fi  
Details
Expired 2019-01-01
pelaajaboardcast.fi https://pelaajaboardcast.fi/  
Details
Screenshot
2021-10-07
pesapalloforum.fi No DNS records found  
Details
2021-01-18
pesisforum.fi https://www.supervuoro.com/  
Details
Screenshot
2023-01-18
pesisportaali.fi http://www.pesisportaali.fi/  
Details
Screenshot
2021-01-05
pienisuuriidea.fi https://pienisuuriidea.fi/  
Details
Screenshot
2021-10-15
pomarkunpyry.fi https://www.pomarkunpyry.fi/  
Details
Screenshot
2021-03-09
pompy.fi https://pomarkunpyry.fi/  
Details
Screenshot
2021-03-09
ps82.fi  
Details
Expired 2018-03-07
rakennuskiviranta.fi  
Details
Screenshot
Expired 2020-03-02
rakennuspalvelujarvinen.fi http://www.rakennuspalvelujarvinen.fi/  
Details
Screenshot
2021-04-21
reseptikilpailu.fi https://www.reseptikilpailu.fi/  
Details
Screenshot
2020-12-06
roskala.fi  
Details
Screenshot
Expired 2000-12-31
route55.fi http://www.route55.fi/  
Details
Screenshot
2021-10-26
salibandyforum.fi http://www.salibandyforum.fi/  
Details
Screenshot
2021-01-04
salonsaxin.fi https://salonsaxin.fi/  
Details
Screenshot
2021-05-15
sarmeen.fi http://www.sarmeen.fi/  
Details
Screenshot
2021-05-25
satakunnanurheiluklinikka.fi https://satakunnanurheiluklinikka.fi/  
Details
Screenshot
2021-09-13
siilibarterrace.fi http://www.siilibarterrace.fi/  
Details
Screenshot
2021-03-29
sillanmaki.fi https://www.sillanmaki.fi/  
Details
Screenshot
2020-12-11
snowracers.fi http://www.snowracers.fi/  
Details
Screenshot
2021-09-12
so11.fi https://design.yt/  
Details
Screenshot
2021-04-18
suomenravintolalaite.fi https://suomenravintolalaite.fi/  
Details
Screenshot
2021-09-06
sähkösun.fi https://xn--shksun-bua0m.fi/  
Details
Screenshot
2021-07-27
tacogarcia.fi https://www.tacogarcia.fi/  
Details
Screenshot
2021-01-05
taksileponiemi.fi https://taksileponiemi.fi/  
Details
Screenshot
2020-12-14
tiinajalasse.fi  
Details
Expired 2019-02-26
tilataksipori.fi https://klsalminen.fi/  
Details
Screenshot
2021-02-12
tomoottajat.fi http://tomoottajat.fi/  
Details
Screenshot
2021-03-19
valokuvaajapauliinap.fi  
Details
Screenshot
Expired 2000-12-31
varastoon.fi https://varastoon.fi/  
Details
Screenshot
2021-08-19
verkkokauppakorpela.fi http://www.verkkokauppakorpela.fi/  
Details
Screenshot
2021-11-16
vientiautot.fi https://www.vientiautot.fi/  
Details
Screenshot
2021-05-10
vikapihalle.fi https://www.vikapihalle.fi/  
Details
Screenshot
2021-10-11
yli-rami.fi http://www.yli-rami.fi/  
Details
Screenshot
2021-02-08