kankaanp%C3%A4%C3%A4nmetsastysyhdistys.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)Holder | (Linking of this domain to above company is not coming from Traficom records!) |
IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
Server IP not valid or missing details in database. Map not shown
Word cloud for kankaanp%C3%A4%C3%A4nmetsastysyhdistys.fi
Sorry, not enough data to parse a word cloud for this site at this time
Cookie data for kankaanp%C3%A4%C3%A4nmetsastysyhdistys.fi
Source: Actual web page - Timestamp: Number of cookies: 1
Cookie domain | Cookie values |
---|---|
kankaanpaanmetsastysyhdistys.fi | Cookie name: c45606c2ad182d6419988ebe1e6273d9 Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 58 bytes |
Screenshot for kankaanp%C3%A4%C3%A4nmetsastysyhdistys.fi
DNS records for kankaanp%C3%A4%C3%A4nmetsastysyhdistys.fi
Source: DNS reponse - Timestamp:
Whois record history for kankaanp%C3%A4%C3%A4nmetsastysyhdistys.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
Date |
---|
Server response for kankaanp%C3%A4%C3%A4nmetsastysyhdistys.fi
Source: Web server reponse - Timestamp: Final URL | |
HTTP Return Code | |
IP Address | |
Server Header | Server: Via: |
Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on kankaanp%C3%A4%C3%A4nmetsastysyhdistys.fi
Source: Web page analysis - Timestamp: Latest review | |
Page language (from header) | (This is often false!) |
Technologies |
Known subdomains for kankaanp%C3%A4%C3%A4nmetsastysyhdistys.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700No subdomains found
Web hosting providers
Source: All valid company websites with content (see below table)Not enough data to present a graph