hypnoterapia.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)State | Registered |
Holder | Köydenpunojankatu 2 B 8, Finland |
Grant Date | 2014-08-20 |
Last Validity Date | 2024-08-20 |
Registrar | Planeetta Internet Oy 20100 Turku |
Name Servers Please see DNS section for details | ns1.hostingpalvelu.fi ns2.hostingpalvelu.fi |
Is The DNSSec in Use | No |
IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2022-10-19 16:02WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
IP source | IP address | ASN block data | IP Geolocation |
---|---|---|---|
User IP | 3.149.233.72 | This is not retrieved for now | Country: United States (US) City: Postal code: Latitude: 37.751 Longitude: -97.822 Network: 3.144.0.0/12 |
Server IP | Autonomous System (AS) #: 15830 BGP prefix: 31.217.192.0/23 Country Code: FI Registry: ripencc Allocated: 2011-08-17 Info: EQUINIX-CONNECT-EMEA, GB | Country: Finland (FI) State: Southern Savonia (04) City: Mikkeli Postal code: 50130 Latitude: 61.6782 Longitude: 27.2423 Network: 31.217.192.0/21 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Word cloud for hypnoterapia.fi
Source: Actual web page - Timestamp: 2022-10-19 16:02Notice: Miscellaneous words removed from the cloud to enhance the analytics
Web page details for hypnoterapia.fi
Source: Actual web page - Timestamp: 2022-12-03 06:06Header data & Meta tags | title Etusivu - www.hypnoterapia.fi keywords terveydenhoito, hoiva-ala, hammaslääkäri, terapeutti, hieronta, kosmetiikka, lääketiede, terapeutit, optikko, fysioterapeutti generator Hostingpalvelu.fi Kotisivukone 12.0.8 not_found text/html; charset=UTF-8 description Kattavat yleislääkäri-, työterveys-, erikoislääkäri- ja sairaalapalvelut yrityksen työntekijöille ja yksityisille. |
Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
Cascading Style Sheets (CSS) (CSS) | css/text-2c40b32f-185d-de59-2146-673669cbf67e.css modules/navigation/navigation.css css/text-4cb70648-c73a-41ca-9922-dd02130afdcc.css css/text-7f9f02b0-f8b7-4e47-ad4c-25f8dde37423.css //fonts.googleapis.com/css?family=lobster&subset=latin%2clatin-ext%2ccyrillic%2ccyrillic-ext //fonts.googleapis.com/css?family=quando&subset=latin%2clatin-ext css/style.css css/text-a46da74f-f2d5-4a10-ae48-6144614133b4.css css/text-4aafda91-3b6a-4dda-b022-bc0e5600f189.css css/navigation-a7fe368b-1a50-4842-bdd8-5c2c835402ff.css css/header-268e1ef5-ec35-4229-905d-c42dee691a83.css modules/text/text.css css/layout.css css/text-bbffa62c-bcda-1b60-a021-e50e26393cf0.css css/text-f864985c-23bf-7b49-a87b-2c18d3b82360.css |
Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
JavaScript libraries | components/jquery/jquery.min.js?ac=12.0.8_2012073117 js/helpers.js js/view.js modules/text/text.js?ac=12.0.8_2012073117 js/anti_cache.js?ac=12.0.8_2012073117 js/css_browser_selector.js |
Cookie data for hypnoterapia.fi
Source: Actual web page - Timestamp: 2022-12-03 06:06Number of cookies: 0
Cookie domain | Cookie values |
---|
Screenshot for hypnoterapia.fi
Source: Actual web page - Timestamp: 2022-10-19 16:02
DNS records for hypnoterapia.fi
Source: DNS reponse - Timestamp: 2022-10-19 16:02A | hypnoterapia.fi 31.217.192.164 (Time to Live: 359) |
MX | securemail1.hostingservice.fi (Time to Live: 3600) securemail2.hostingservice.fi (Time to Live: 3600) |
NS | ns1.hostingpalvelu.fi
|
SOA | hypnoterapia.fi ns1.hostingpalvelu.fi (Time to Live: 21600) info.hostingpalvelu.fi |
TXT | SPF records: v=spf1 ip4:31.217.192.61 +a +mx +ip4:31.217.192.164 +ip4:31.217.192.165 ~all |
Whois record history for hypnoterapia.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
Date | 2021-01-19 | 2021-08-04 | 2021-11-19 | 2022-08-04 | 2023-08-04 |
---|---|---|---|---|---|
Name | hypnoterapia.fi | hypnoterapia.fi | hypnoterapia.fi | hypnoterapia.fi | hypnoterapia.fi |
State | Registered | Registered | Registered | Registered | Registered |
Holder | Metodi OSK | Metodi OSK | Metodi OSK | Metodi OSK | Metodi OSK |
Address | Köydenpunojankatu 2 B 8 | Köydenpunojankatu 2 B 8 | Köydenpunojankatu 2 B 8 | Köydenpunojankatu 2 B 8 | Köydenpunojankatu 2 B 8 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2014-08-20T13:03:14 | 2014-08-20T13:03:14 | 2014-08-20T13:03:14 | 2014-08-20T13:03:14 | 2014-08-20T13:03:14 |
Registrar | Suomen Hostingpalvelu Oy | Suomen Hostingpalvelu Oy | Planeetta Internet Oy | Planeetta Internet Oy | Planeetta Internet Oy |
PostalArea | Turku | Turku | Turku | Turku | Turku |
PostalCode | 20100 | 20100 | 20100 | 20100 | 20100 |
NameServer1 | ns1.hostingpalvelu.fi | ns1.hostingpalvelu.fi | ns1.hostingpalvelu.fi | ns1.hostingpalvelu.fi | ns1.hostingpalvelu.fi |
NameServer2 | ns2.hostingpalvelu.fi | ns2.hostingpalvelu.fi | ns2.hostingpalvelu.fi | ns2.hostingpalvelu.fi | ns2.hostingpalvelu.fi |
PhoneNumber | |||||
IsDNSSecInUse | no | no | no | no | no |
OrganizationId | 1963639-1 | 1963639-1 | 1963639-1 | 1963639-1 | 1963639-1 |
AssociationType | Company | Company | Company | Company | Company |
LastValidityDate | 2021-08-20T11:23:25 | 2022-08-20T11:23:25 | 2022-08-20T11:23:25 | 2023-08-20T11:23:25 | 2024-08-20T11:23:25 |
DepartmentOrContactPerson |
Server response for hypnoterapia.fi
Source: Web server reponse - Timestamp: 2022-10-19 16:02Final URL | http://www.hypnoterapia.fi/ |
HTTP Return Code | HTTP/1.1 200 OK |
IP Address | 31.217.192.164 Autonomous System (AS) #: 15830 BGP prefix: 31.217.192.0/23 Country Code: Finland (FI) Registry: ripencc Allocated: 2011-08-17 Info: EQUINIX-CONNECT-EMEA, GB |
Server Header | Server: Apache Via: |
Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on hypnoterapia.fi
Source: Web page analysis - Timestamp: 2022-10-19 16:02Latest review | 2022-10-19 16:02 |
Page language (from header) | (This is often false!) |
Technologies |
Known subdomains for hypnoterapia.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700Number of subdomains found: 6
Subdomain | IP address |
---|---|
autodiscover.hypnoterapia.fi | |
cpanel.hypnoterapia.fi | 31.217.192.164 |
mail.hypnoterapia.fi | 31.217.192.164 |
webdisk.hypnoterapia.fi | 31.217.192.164 |
webmail.hypnoterapia.fi | 31.217.192.164 |
www.hypnoterapia.fi | 31.217.192.164 |
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 9
Domain name | Final URL (when last tested) | Links | Last validity |
---|---|---|---|
aleksijalava.fi | http://www.aleksijalava.fi/ | 2024-09-14 | |
hypnoterapia.fi | http://www.hypnoterapia.fi/ | 2024-08-20 | |
kognitiivinenkayttaytymisterapia.fi | http://xn--kognitiivinenkyttytymisterapia-8scd.fi/ | 2025-01-28 | |
kognitiivinenkäyttäytymisterapia.fi | http://www.xn--kognitiivinenkyttytymisterapia-8scd.fi/ | 2025-01-28 | |
koulupsykologipalvelu.fi | http://www.koulupsykologipalvelu.fi/ | 2024-08-20 | |
metodi.fi | No DNS records found | 2024-08-12 | |
paripsykoterapiaa.fi | http://www.paripsykoterapiaa.fi/ | 2024-09-29 | |
pariterapiaa.fi | http://www.pariterapiaa.fi/ | 2024-09-29 | |
sateenkaarisohva.fi | http://www.sateenkaarisohva.fi/ | 2025-03-24 |