halkivahanmetsastysyhdistys.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)State | Registered |
Holder | Niitoksentie 53C, Finland |
Grant Date | 2014-08-15 |
Last Validity Date | 2024-08-15 |
Registrar | HD-decor Oy 31730 Honkola |
Name Servers Please see DNS section for details | ns1.tietokettu.net ns2.tietokettu.net |
Is The DNSSec in Use | No |
IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2022-11-01 16:16WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
IP source | IP address | ASN block data | IP Geolocation |
---|---|---|---|
User IP | 18.118.2.15 | This is not retrieved for now | Country: United States (US) City: Postal code: Latitude: 37.751 Longitude: -97.822 Network: 18.116.0.0/14 |
Server IP | Autonomous System (AS) #: 16509 BGP prefix: 52.208.0.0/13 Country Code: US Registry: arin Allocated: 2015-09-02 Info: AMAZON-02, US | Country: Ireland (IE) State: Leinster (L) City: Dublin Postal code: D02 Latitude: 53.3338 Longitude: -6.2488 Network: 52.208.0.0/13 |
This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.
Word cloud for halkivahanmetsastysyhdistys.fi
Source: Actual web page - Timestamp: 2022-11-01 16:16Notice: Miscellaneous words removed from the cloud to enhance the analytics
Web page details for halkivahanmetsastysyhdistys.fi
Source: Actual web page - Timestamp: 2022-12-03 23:06Header data & Meta tags | title Halkivahan Metsästysyhdistys ry keywords Halkivahan Metsästysyhdistys ry viewport width=device-width, initial-scale=1 not_found text/html; charset=ISO-8859-1text/html; charset=ISO-8859-1. description Halkivahan Metsästysyhdistys ry:n kotisivut |
Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
Cascading Style Sheets (CSS) (CSS) | https://asiakas.kotisivukone.com/files/halkivahanmetsastysyhdistys.kotisivukone.com/.css/stylesheet-29.css https://fonts.googleapis.com/css?family=open+sans https://cdn.kotisivukone.fi/r201/b3340/clients/css/common.css https://cdn.kotisivukone.fi/r201/b3340/clients/css/responsive/tablet_responsive.css https://cdn.kotisivukone.fi/libs/jquery/ui/css/jquery-ui-1.8.20.custom.min.css https://cdn.kotisivukone.fi/r201/b3340/clients/css/responsive/narrow_responsive.css https://cdn.kotisivukone.fi/r201/b3340/clients/css/responsive/common_responsive.css https://cdn.kotisivukone.fi/r201/b3340/clients/css/responsive/mobile_responsive.css |
Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
JavaScript libraries | //ajax.googleapis.com/ajax/libs/jqueryui/1.13.1/jquery-ui.min.js //cdnjs.cloudflare.com/ajax/libs/underscore.js/1.7.0/underscore-min.js https://cdn.kotisivukone.fi/r201/b3340/clients/js/kotisivukone.js //ajax.googleapis.com/ajax/libs/prototype/1.7.2.0/prototype.js https://cdn.kotisivukone.fi/r201/b3340/clients/js/kotisivukone_responsive.js //code.jquery.com/jquery-3.6.0.min.js https://cmp.osano.com/azqnnqsxxwuessow/ed564b93-8187-4b26-90c4-a760320547ef/osano.js |
Cookie data for halkivahanmetsastysyhdistys.fi
Source: Actual web page - Timestamp: 2022-12-03 23:06Number of cookies: 1
Cookie domain | Cookie values |
---|---|
www.halkivahanmetsastysyhdistys.fi | Cookie name: JSESSIONID Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 42 bytes |
Screenshot for halkivahanmetsastysyhdistys.fi
Source: Actual web page - Timestamp: 2022-11-01 16:16
DNS records for halkivahanmetsastysyhdistys.fi
Source: DNS reponse - Timestamp: 2022-11-01 16:16A | halkivahanmetsastysyhdistys.fi 54.76.107.51 (Time to Live: 50) |
MX | mail.halkivahanmetsastysyhdistys.fi (Time to Live: 50) |
NS | ns-1682.awsdns-18.co.uk
|
SOA | halkivahanmetsastysyhdistys.fi ns-219.awsdns-27.com (Time to Live: 900) awsdns-hostmaster.amazon.com |
Whois record history for halkivahanmetsastysyhdistys.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
Date | 2022-07-19 | 2023-01-04 | 2023-06-22 | 2023-10-04 | 2023-12-19 |
---|---|---|---|---|---|
Name | halkivahanmetsastysyhdistys.fi | halkivahanmetsastysyhdistys.fi | halkivahanmetsastysyhdistys.fi | halkivahanmetsastysyhdistys.fi | halkivahanmetsastysyhdistys.fi |
State | Registered | Registered | Registered | Registered | Registered |
Holder | Halkivahan Metsästysyhdistys ry | Halkivahan Metsästysyhdistys ry | Halkivahan Metsästysyhdistys ry | Halkivahan Metsästysyhdistys ry | Halkivahan Metsästysyhdistys ry |
Address | Niitoksentie 53C | Niitoksentie 53C | Niitoksentie 53C | Niitoksentie 53C | Niitoksentie 53C |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2014-08-15T19:42:59 | 2014-08-15T19:42:59 | 2014-08-15T19:42:59 | 2014-08-15T19:42:59 | 2014-08-15T19:42:59 |
Registrar | Fonecta Oy | Telia Inmics-Nebula Oy | Telia Inmics-Nebula Oy | Telia Finland Oyj | HD-decor Oy |
PostalArea | Honkola | Honkola | Honkola | Honkola | Honkola |
PostalCode | 31730 | 31730 | 31730 | 31730 | 31730 |
NameServer1 | ns-1312.awsdns-36.org | ns1.webhotelli.fi | ns1.webhotelli.fi | ns1.webhotelli.fi | ns1.tietokettu.net |
NameServer2 | ns-1682.awsdns-18.co.uk | ns2.webhotelli.fi | ns2.webhotelli.fi | ns2.webhotelli.fi | ns2.tietokettu.net |
PhoneNumber | |||||
IsDNSSecInUse | no | no | no | no | no |
OrganizationId | 0305646-4 | 0305646-4 | 0305646-4 | 0305646-4 | 0305646-4 |
AssociationType | Foundation | Foundation | Foundation | Foundation | Foundation |
LastValidityDate | 2023-08-15T19:42:59 | 2023-08-15T19:42:59 | 2024-08-15T19:42:59 | 2024-08-15T19:42:59 | 2024-08-15T19:42:59 |
DepartmentOrContactPerson |
Server response for halkivahanmetsastysyhdistys.fi
Source: Web server reponse - Timestamp: 2022-11-01 16:16Final URL | https://www.halkivahanmetsastysyhdistys.fi/ |
HTTP Return Code | HTTP/1.1 200 OK |
IP Address | 52.211.40.71 Autonomous System (AS) #: 16509 BGP prefix: 52.208.0.0/13 Country Code: United States (US) Registry: arin Allocated: 2015-09-02 Info: AMAZON-02, US |
Server Header | Server: Nginx/1.18.0 Via: |
Certificate | Issued By: Let's Encrypt Issuer details: O=Let's Encrypt, United States (US) Issuer details: CN=R3 Version: 2 Algorithm: RSA-SHA256 Issued On: 2022-09-14 00:00:00 Expires On: 2022-12-13 00:00:00 |
Certificate Subject | Country (C): Location (L): Organization (O): Common Name (CN): halkivahanmetsastysyhdistys.fi |
Certificate Alternative Names | halkivahanmetsastysyhdistys.fi www.halkivahanmetsastysyhdistys.fi |
Used technologies on halkivahanmetsastysyhdistys.fi
Source: Web page analysis - Timestamp: 2022-11-01 16:16Latest review | 2022-11-01 16:16 |
Page language (from header) | en-US (This is often false!) |
Technologies | Elementor 3.8.0 (Landing Page Builders) (100% propable) Google Font API (Font Scripts) (100% propable) Nginx (Web ServersReverse Proxy) (100% propable) Swiper Slider (Miscellaneous) (100% propable) WP Rocket 3.11.0.5 (Cache Tools) (100% propable) WordPress 5.9.5 (CMSBlogs) (100% propable) Yoast SEO 19.9 (SEO) (100% propable) jQuery 3.6.5 (JavaScript Libraries) (100% propable) jQuery Migrate 3.3.2 (JavaScript Libraries) (100% propable) |
Known subdomains for halkivahanmetsastysyhdistys.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700Number of subdomains found: 1
Subdomain | IP address |
---|---|
www.halkivahanmetsastysyhdistys.fi | 109.204.224.162 |
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 1
Domain name | Final URL (when last tested) | Links | Last validity |
---|---|---|---|
halkivahanmetsastysyhdistys.fi | https://www.halkivahanmetsastysyhdistys.fi/ | 2024-08-15 |