This domain name is no longer valid. You are looking at historical records

auto-sabo.fi  


Details
 
Server IP geolocation
 
Word cloud
 
Web page details & SOME
 
Cookie data
 
Screenshot
 
DNS records
 
Whois history
 
Server response
 
Used technologies
 
Subdomains
 
Hosting
 
Holders domains
 


Details

Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)
StateValidity expired
Holder Kievarinkatu 5, Finland

Grant Date2020-08-06
Last Validity Date2022-08-06
Registrarwww design
38840 Niinisalo
Name Servers
Please see DNS section for details
ns1.nettipertti.fi
ns2.nettipertti.fi
Is The DNSSec in Use No
IANA details for suffixTop Level Domain (TLD): FI
TLD manager: Finnish Transport and Communications Agency Traficom
Domain type: Country-code



Server IP location

Source: Actual web page - Timestamp: 2022-07-05 16:50
WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
IP sourceIP addressASN block dataIP Geolocation
User IP3.229.124.74This is not retrieved for nowCountry: United States   (US)
State: Virginia (VA)
City: Ashburn
Postal code: 20149
Latitude: 39.0481
Longitude: -77.4728
Network: 3.224.0.0/12
Server IPAutonomous System (AS) #: 24940
BGP prefix: 95.217.0.0/16
Country Code: DE
Registry: ripencc
Allocated: 2009-02-24
Info: HETZNER-AS, DE
Country: Germany   (DE)
City:
Postal code:
Latitude: 51.2993
Longitude: 9.491
Network: 95.217.128.0/17

This product includes GeoLite2 data created by MaxMind, available from https://www.maxmind.com.



Word cloud for auto-sabo.fi

Source: Actual web page - Timestamp: 2022-07-05 16:50
Notice: Miscellaneous words removed from the cloud to enhance the analytics



Web page details for auto-sabo.fi

Source: Actual web page - Timestamp: 2022-08-03 15:24
Header data & Meta tagstitle Apache2 Debian Default Page: It works
not_found text/html; charset=UTF-8
Open Graph (OG) meta tagsUsing Open Graph tags is highly recommended for Search Engine Optimization (SEO)
Twitter cardsUsing Twitter tags is highly recommended for Search Engine Optimization (SEO)
Cascading Style Sheets (CSS) (CSS)
Social Media (SOME) linksHaving Social Media content is highly recommended for Search Engine Optimization (SEO)
JavaScript libraries



Cookie data for auto-sabo.fi

Source: Actual web page - Timestamp: 2022-08-03 15:24
Number of cookies: 0
Cookie domainCookie values



Screenshot for auto-sabo.fi

Source: Actual web page - Timestamp: 2022-07-05 16:50
Screenshot for auto-sabo.fi



DNS records for auto-sabo.fi

Source: DNS reponse - Timestamp: 2022-07-05 16:50
Aauto-sabo.fi    95.217.149.110  (Time to Live: 3599)
MXposti.nettipertti.fi (Time to Live: 3600)
NSns1.nettipertti.fins2.nettipertti.fi
SOAauto-sabo.fi    ns1.nettipertti.fi (Time to Live: 21600)
hostmaster.nettipertti.fi
TXTSPF records:
v=spf1
mx
~all



Whois record history for auto-sabo.fi

Source: Finnish Transport and Communications Agency (Traficom)
Showing latest max 5 detected changes in the records. Changes are highlighted
Date2020-08-072021-01-192021-08-072021-09-042022-08-07
Name auto-sabo.fi auto-sabo.fi auto-sabo.fi auto-sabo.fi auto-sabo.fi
State Registered Registered Validity expired Registered Validity expired
Holder www design www design www design www design www design
Address Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5 Kievarinkatu 5
Country   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)   Finland (FI)
GrantDate 2020-08-06T17:52:06.643 2020-08-06T17:52:06.643 2020-08-06T17:52:06.643 2020-08-06T17:52:06.643 2020-08-06T17:52:06.643
Registrar www design www design www design www design www design
PostalArea Niinisalo Niinisalo Niinisalo Niinisalo Niinisalo
PostalCode 38840 38840 38840 38840 38840
NameServer1 ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi ns1.nettipertti.fi
NameServer2 ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi ns2.nettipertti.fi
PhoneNumber +385456701770    
IsDNSSecInUse no  no  no  no  no
OrganizationId 2503281-8 2503281-8 2503281-8 2503281-8 2503281-8
AssociationType Company Company Company Company Company
LastValidityDate 2021-08-06T17:52:06.643 2021-08-06T17:52:06.643 2021-08-06T17:52:06.643 2022-08-06T17:52:06.643 2022-08-06T17:52:06.643
DepartmentOrContactPerson     



Server response for auto-sabo.fi

Source: Web server reponse - Timestamp: 2022-07-05 16:50
Final URLhttp://www.auto-sabo.fi/
HTTP Return CodeHTTP/1.1 200 OK
IP Address
95.217.149.110 
Autonomous System (AS) #: 24940
BGP prefix: 95.217.0.0/16
Country Code:  Germany (DE)
Registry: ripencc
Allocated: 2009-02-24
Info: HETZNER-AS, DE
Server HeaderServer: Apache
Via:
Certificate Not available
Using certificate is highly recommended for Search Engine Optimization (SEO)
If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address



Used technologies on auto-sabo.fi

Source: Web page analysis - Timestamp: 2022-07-05 16:50
Latest review2022-07-05 16:50
Page language (from header)fi (This is often false!)
TechnologiesBootstrap Bootstrap (UI Frameworks) (100% propable)
Font Awesome Font Awesome 5.0.8 (Font Scripts) (100% propable)
LiteSpeed LiteSpeed (Web Servers) (100% propable)
MediaElement.js MediaElement.js 4.2.16 (Video Players) (100% propable)
WordPress WordPress 5.9.3 (CMSBlogs) (100% propable)
Yoast SEO Yoast SEO 18.0 (SEO) (100% propable)
jQuery jQuery 4.14.7 (JavaScript Libraries) (100% propable)
jQuery Migrate jQuery Migrate 3.3.2 (JavaScript Libraries) (100% propable)
jQuery Mobile jQuery Mobile 4.14.7 (Mobile Frameworks) (100% propable)



Known subdomains for auto-sabo.fi

Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700
No subdomains found



Web hosting providers

Source: All valid company websites with content (see below table)



Domains owned by same owner (current and past)

Source: Finnish Transport and Communications Agency (Traficom)
Number of domains: 139
Domain nameFinal URL
(when last tested)
LinksLast validity
4321.fi  
Details
Screenshot
Expired 2022-01-11
ad-kpaa.fi https://kankaanpaanautohuolto.fi/  
Details
Screenshot
2023-04-20
ahofarm.fi  
Details
Expired 2000-12-31
auto-sabo.fi  
Details
Screenshot
Expired 2022-08-06
autosabo.fi  
Details
Screenshot
Expired 2022-08-06
avainauto.fi  
Details
Screenshot
Expired 2022-07-31
benzboy.fi  
Details
Expired 2018-08-14
design-suomi.fi  
Details
Screenshot
Expired 2019-10-23
discgolfstore.fi https://www.frisbeegolf-forum.fi/  
Details
Screenshot
2023-02-08
driveit.fi  
Details
Screenshot
Expired 2020-01-22
elinvoimainenkankaanpaa.fi http://www.elinvoimainenkankaanpaa.fi/  
Details
Screenshot
2022-09-06
eurogarment.fi  
Details
Screenshot
Expired 2020-07-05
fixus-kankaanpaa.fi https://kankaanpaanautohuolto.fi/  
Details
Screenshot
2023-03-31
frisbeegolf-forum.fi https://www.frisbeegolf-forum.fi/  
Details
Screenshot
2023-01-01
frisbeegolfkauppa.fi http://www.frisbeegolfkauppa.fi/  
Details
Screenshot
2023-02-08
futsalforum.fi https://www.futsalforum.fi/  
Details
Screenshot
2022-12-13
geopark-suomi.fi https://geopark-suomi.fi/  
Details
Screenshot
2023-04-30
grillivaunut.fi http://www.grillivaunut.fi/  
Details
Screenshot
2023-01-18
hatax.fi https://hatax.fi/  
Details
Screenshot
2022-12-03
hevosenhetki.fi  
Details
Screenshot
Expired 2021-05-25
hotellitoholampi.fi  
Details
Screenshot
Expired 2019-08-14
ilmalampopumppukauppa.fi http://www.ilmalampopumppukauppa.fi/  
Details
Screenshot
2023-06-14
ilmavideot.fi http://www.ilmavideot.fi/  
Details
Screenshot
2022-08-26
itpaja.fi  
Details
Screenshot
Expired 2020-03-23
itpalvelukallionkieli.fi  
Details
Screenshot
Expired 2020-05-02
jaanantaksi.fi No DNS records found  
Details
2022-12-13
jk-inks.fi  
Details
Expired 2018-12-10
jvsahkoasennus.fi No DNS records found  
Details
2023-08-04
jvsähköasennus.fi No DNS records found  
Details
2023-08-04
kalastustukku.fi http://www.kalastustukku.fi/  
Details
Screenshot
2023-01-22
kama1958.fi http://www.kama1958.fi/  
Details
Screenshot
2023-06-14
kangasfysio.fi  
Details
Screenshot
Expired 2020-02-04
kankaanpaanautohuolto.fi http://www.kankaanpaanautohuolto.fi/  
Details
2023-03-10
kankaanpaanjoulu.fi  
Details
Screenshot
Expired 2019-11-02
kankaanpäänjoulu.fi  
Details
Screenshot
Expired 2019-11-02
kankaanpaanlasi.fi https://xn--kankaanpnlasi-ifba.fi/  
Details
Screenshot
2022-12-13
kankaanpäänlasi.fi No DNS records found  
Details
2022-08-26
kankaanpaanmetsastysyhdistys.fi https://www.kankaanpaanmetsastysyhdistys.fi/  
Details
Screenshot
2022-11-22
kankaanpäänmetsastysyhdistys.fi https://kankaanpaanmetsastysyhdistys.fi/  
Details
Screenshot
2022-11-22
kankaanpäänmetsästysyhdistys.fi http://kankaanpaanmetsastysyhdistys.fi/  
Details
Screenshot
2023-02-26
kankaanpaanomaishoitajat.fi http://www.kankaanpaanomaishoitajat.fi/  
Details
Screenshot
2023-02-01
katalysaattorit.fi http://www.katalysaattorit.fi/  
Details
Screenshot
2023-02-19
katsastusasemat.fi http://www.katsastusasemat.fi/  
Details
Screenshot
2023-03-26
kaupunkiseikkailu.fi https://design.yt/  
Details
Screenshot
2023-05-10
kesyry.fi No DNS records found  
Details
2023-03-22
kiikanwallin.fi https://kiikanwallin.fi/  
Details
Screenshot
2023-07-30
kotiyleiso.fi  
Details
Screenshot
Expired 2019-06-21
kpaalasi.fi https://xn--kankaanpnlasi-ifba.fi/  
Details
Screenshot
2023-02-17
kuninkaanlahde.fi https://www.design.yt/  
Details
Screenshot
2023-03-19
kuninkaanlähde.fi http://www.xn--kuninkaanlhde-kfb.fi/  
Details
Screenshot
2023-03-03
laboratoriotarvike.fi http://www.laboratoriotarvike.fi/  
Details
Screenshot
2023-02-03
lammoneriste.fi http://www.lammoneriste.fi/  
Details
Screenshot
2023-02-02
lämmöneriste.fi http://www.xn--lmmneriste-q5a2t.fi/  
Details
Screenshot
2023-02-02
lämpöpumppukauppa.fi https://wattila.fi/  
Details
Screenshot
2023-01-30
lampopumppukeskus.fi http://www.lampopumppukeskus.fi/  
Details
Screenshot
2023-02-25
lauantaitorit.fi http://www.lauantaitorit.fi/  
Details
Screenshot
2023-04-05
lekatec.fi  
Details
Screenshot
Expired 2021-07-30
lelesb.fi http://www.lelesb.fi/  
Details
Screenshot
2023-08-11
lemppu.fi http://www.lemppu.fi/  
Details
Screenshot
2023-05-25
lemppulegends.fi http://www.lemppulegends.fi/  
Details
Screenshot
2022-08-25
leppisfishing.fi  
Details
Screenshot
Expired 2022-03-26
levinhenkireika.fi https://levinhenkireika.fi/  
Details
Screenshot
2023-05-02
löytökorpi.fi http://www.xn--lytkorpi-n4ac.fi/  
Details
Screenshot
2023-03-17
maila.fi http://www.maila.fi/  
Details
Screenshot
2023-02-22
meggala.fi  
Details
Screenshot
Expired 2021-12-27
metsastyskeskustelu.fi http://www.metsastyskeskustelu.fi/  
Details
Screenshot
2023-01-22
mm-kaupat.fi http://www.mm-kaupat.fi/  
Details
Screenshot
2023-06-06
monioljypoltin.fi No DNS records found  
Details
2023-05-21
monioljypolttimenvaraosat.fi http://www.monioljypolttimenvaraosat.fi/  
Details
Screenshot
2022-11-16
monioljypolttimet.fi http://www.monioljypolttimet.fi/  
Details
Screenshot
2022-08-26
mpvarikko.fi  
Details
Screenshot
Expired 2021-05-03
murskamies.fi http://www.murskamies.fi/  
Details
Screenshot
2022-12-30
myyntivaunut.fi http://www.myyntivaunut.fi/  
Details
Screenshot
2023-05-30
neoen.fi http://www.neoen.fi/  
Details
Screenshot
2022-09-29
neoen-finland.fi http://www.neoen-finland.fi/  
Details
Screenshot
2022-09-29
nesvuokrapelit.fi  
Details
Screenshot
Expired 2000-12-31
nettipalvelin.fi http://www.nettipalvelin.fi/  
Details
Screenshot
2023-01-11
nettipertti.fi http://www.nettipertti.fi/  
Details
Screenshot
2022-12-02
nonstopparturi.fi http://www.nonstopparturi.fi/  
Details
Screenshot
2022-12-03
northecoclean.fi  
Details
Screenshot
Expired 2021-09-29
nuhvi.fi https://www.nuhvi.fi/index.php/fi/  
Details
Screenshot
2023-02-25
ohjelmasiili.fi  
Details
Screenshot
Expired 2019-08-24
ohjelmatoimistosiili.fi  
Details
Screenshot
Expired 2020-09-04
öljysäiliö.fi  
Details
Screenshot
Expired 2022-03-25
olkimix.fi  
Details
Screenshot
Expired 2019-06-26
oulunautohuolto.fi http://www.oulunautohuolto.fi/  
Details
Screenshot
2023-01-22
oxdog.fi http://www.oxdog.fi/  
Details
Screenshot
2022-11-20
pauliinap.fi  
Details
Screenshot
Expired 2000-12-31
pe-53.fi  
Details
Expired 2019-01-01
pelaajaboardcast.fi No DNS records found  
Details
2022-10-07
pesapalloforum.fi http://www.pesapalloforum.fi/  
Details
Screenshot
2023-01-18
pesisforum.fi No DNS records found  
Details
2023-01-18
pesisportaali.fi http://www.pesisportaali.fi/  
Details
Screenshot
2023-01-05
pienisuuriidea.fi https://pienisuuriidea.fi/  
Details
Screenshot
2022-10-15
pirkanmaanpohjarakennus.fi https://pirkanmaanpohjarakennus.fi/  
Details
Screenshot
2022-09-23
pomarkunpyry.fi https://design.yt/  
Details
Screenshot
2023-03-09
pompy.fi https://design.yt/  
Details
Screenshot
2023-03-09
ps82.fi  
Details
Expired 2018-03-07
putkiasennusta.fi http://www.putkiasennusta.fi/  
Details
Screenshot
2023-01-22
rajalamotorsport.fi http://www.rajalamotorsport.fi/  
Details
Screenshot
2023-04-30
rakennuskiviranta.fi  
Details
Screenshot
Expired 2020-03-02
rakennuspalvelujarvinen.fi http://www.rakennuspalvelujarvinen.fi/  
Details
Screenshot
2023-04-21
raskaskonehuolto.fi  
Details
Screenshot
Expired 2022-07-29
raskaskonekorjaus.fi  
Details
Screenshot
Expired 2022-07-29
reseptikilpailu.fi  
Details
Expired 2021-12-06
retkilemi.fi https://retkilemi.fi/  
Details
Screenshot
2023-08-03
roskala.fi  
Details
Screenshot
Expired 2000-12-31
rudanco.fi No DNS records found  
Details
2023-08-09
sähkösun.fi No DNS records found  
Details
2023-07-27
salibandyforum.fi http://www.salibandyforum.fi/  
Details
Screenshot
2023-01-04
salonsaxin.fi https://salonsaxin.fi/  
Details
Screenshot
2023-05-15
sarmeen.fi http://www.sarmeen.fi/  
Details
Screenshot
2023-05-25
satakunnantaksi.fi http://www.satakunnantaksi.fi/  
Details
Screenshot
2023-03-24
satakunnantieisannointi.fi https://satakunnantieisannointi.fi/  
Details
Screenshot
2023-03-05
satakunnanurheiluklinikka.fi  
Details
Screenshot
Expired 2021-09-13
sillanmaki.fi https://www.sillanmaki.fi/  
Details
Screenshot
2022-12-11
snowracers.fi http://www.snowracers.fi/  
Details
Screenshot
2022-09-12
so11.fi https://design.yt/  
Details
Screenshot
2023-04-18
suomenravintolalaite.fi http://www.suomenravintolalaite.fi/  
Details
Screenshot
2022-09-06
tacogarcia.fi  
Details
Screenshot
Expired 2022-01-05
taksileponiemi.fi https://taksileponiemi.fi/  
Details
Screenshot
2022-12-14
tapahtumaviikko.fi http://www.tapahtumaviikko.fi/  
Details
Screenshot
2023-01-22
teollisuusimuri.fi http://www.teollisuusimuri.fi/  
Details
Screenshot
2023-03-11
tieturvakurssi.fi  
Details
Screenshot
Expired 2022-03-26
tiinajalasse.fi  
Details
Expired 2019-02-26
tilataksipori.fi https://tilataksipori.fi/  
Details
Screenshot
2023-02-12
tomoottajat.fi https://tomoottajat.fi/  
Details
Screenshot
2023-03-19
trukkikortti.fi  
Details
Screenshot
Expired 2022-03-26
valokuvaajapauliinap.fi  
Details
Screenshot
Expired 2000-12-31
varastoon.fi https://www.tilacenter.fi/  
Details
Screenshot
2022-08-19
verkkokauppakorpela.fi http://www.verkkokauppakorpela.fi/  
Details
Screenshot
2022-11-16
vervevara.fi No DNS records found  
Details
2023-06-20
vientiautot.fi https://www.vientiautot.fi/  
Details
Screenshot
2023-05-10
vikapihalle.fi  
Details
Screenshot
Expired 2021-10-11
volvo-ohjelmointi.fi https://www.ivolkak.fi/  
Details
Screenshot
2022-10-21
volvoohjelmointi.fi https://www.ivolkak.fi/  
Details
Screenshot
2022-10-21
wwwdesign.fi http://www.wwwdesign.fi/  
Details
Screenshot
2023-01-11
yli-rami.fi http://www.yli-rami.fi/  
Details
Screenshot
2023-02-08
yritysesittelyvideo.fi http://www.yritysesittelyvideo.fi/  
Details
Screenshot
2023-01-22