apconfinland.fi
Details
Source: Finnish Transport and Communications Agency (Traficom) and Internet Assigned Numbers Authority (IANA)State | Validity expired |
Holder | Messuaukio 1, Finland |
Grant Date | 2018-08-16 |
Last Validity Date | 2021-08-16 |
Registrar | Telia Inmics-Nebula Oy 00100 Helsinki |
Name Servers Please see DNS section for details | ns.nebula.fi ns2.nebula.fi |
Is The DNSSec in Use | No |
IANA details for suffix | Top Level Domain (TLD): FI TLD manager: Finnish Transport and Communications Agency Traficom Domain type: Country-code |
Server IP location
Source: Actual web page - Timestamp: 2021-07-01 05:26WARNING: Please notice that the location may be totally wrong if server uses e.g. reverse proxy like Cloudflare
Server IP not valid or missing details in database. Map not shown
Word cloud for apconfinland.fi
Source: Actual web page - Timestamp: 2021-07-01 05:26Notice: Miscellaneous words removed from the cloud to enhance the analytics
Web page details for apconfinland.fi
Source: Actual web page - Timestamp: 2020-12-12 08:06Header data & Meta tags | title Messukeskuksen verkkokauppa / shop.messukeskus.com viewport width=device-width, initial-scale=1, maximum-scale=1, user-scalable=0 not_found empty |
Open Graph (OG) meta tags | Using Open Graph tags is highly recommended for Search Engine Optimization (SEO) |
Twitter cards | Using Twitter tags is highly recommended for Search Engine Optimization (SEO) |
Cascading Style Sheets (CSS) (CSS) | https://chat.puzzel.com/content/client/css/intelecom-light.css https://shop.messukeskus.com/static/studio/pub/system/branches/master/css/messukeskus.min.css?t=1607508911390 |
Social Media (SOME) links | Having Social Media content is highly recommended for Search Engine Optimization (SEO) |
JavaScript libraries | https://chat.puzzel.com/content/client/js/jquery-intelecomchat.libs.latest.min.js https://chat.puzzel.com/content/client/js/jquery-intelecomchat.latest.min.js https://shop.messukeskus.com/static/studio/pub/system/branches/master/js/messukeskus.min.js?t=1607508911390 |
Cookie data for apconfinland.fi
Source: Actual web page - Timestamp: 2020-12-12 08:06Number of cookies: 31
Cookie domain | Cookie values |
---|---|
adform.net | Cookie name: C Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 2 bytes |
adform.net | Cookie name: uid Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 22 bytes |
doubleclick.net | Cookie name: IDE Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 67 bytes |
messukeskus.com | Cookie name: __hssrc Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 8 bytes |
messukeskus.com | Cookie name: __hstc Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 92 bytes |
messukeskus.com | Cookie name: _gcl_au Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 32 bytes |
messukeskus.com | Cookie name: _fbp Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 33 bytes |
messukeskus.com | Cookie name: __hssc Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 31 bytes |
messukeskus.com | Cookie name: _hjAbsoluteSessionInProgress Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 29 bytes |
messukeskus.com | Cookie name: _hjid Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 41 bytes |
messukeskus.com | Cookie name: _hjTLDTest Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 11 bytes |
messukeskus.com | Cookie name: _gat_gtag_UA_11620821_12 Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 25 bytes |
messukeskus.com | Cookie name: _gat_UA-11620821-14 Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 20 bytes |
messukeskus.com | Cookie name: _dc_gtm_UA-11620821-8 Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 22 bytes |
messukeskus.com | Cookie name: _gid Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 30 bytes |
messukeskus.com | Cookie name: _ga Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 30 bytes |
messukeskus.com | Cookie name: hubspotutk Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 42 bytes |
shop.messukeskus.com | Cookie name: _ZB_STATS_VISIT_388633 Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 35 bytes |
shop.messukeskus.com | Cookie name: Stage Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 45 bytes |
shop.messukeskus.com | Cookie name: _ZB_ADMIN_TIME_STAMP_ Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 34 bytes |
shop.messukeskus.com | Cookie name: _ZB_STATS_SS_IMPRESSION.3ebf846c Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 36 bytes |
shop.messukeskus.com | Cookie name: _ZB_STATS_SS_IMPRESSION_PREMIUM_ Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 36 bytes |
shop.messukeskus.com | Cookie name: _ZB_ADMIN_LAST_URL_ Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 51 bytes |
shop.messukeskus.com | Cookie name: _ZB_STATIC_VIEW_THROUGH_WIDGET_1437585 Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 45 bytes |
shop.messukeskus.com | Cookie name: _ZB_STATIC_SS_DR_currentSessionTimeVisit Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 53 bytes |
shop.messukeskus.com | Cookie name: _ZB_STATIC_DR_firstTimeVisit Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 41 bytes |
shop.messukeskus.com | Cookie name: _ZB_STATIC_DR_widgetsUpdateTime Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 116 bytes |
shop.messukeskus.com | Cookie name: zb_test_cookie Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 23 bytes |
shop.messukeskus.com | Cookie name: _hjIncludedInSessionSample Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 27 bytes |
shop.messukeskus.com | Cookie name: _hjIncludedInPageviewSample Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 28 bytes |
shop.messukeskus.com | Cookie name: _ZB_STATIC_LAST_ACCESS_TIME Cookie expiry/purpose: Session cookie (removed after session ends) Cookie size: 40 bytes |
Screenshot for apconfinland.fi
DNS records for apconfinland.fi
Source: DNS reponse - Timestamp: 2021-07-01 05:26
Whois record history for apconfinland.fi
Source: Finnish Transport and Communications Agency (Traficom)Showing latest max 5 detected changes in the records. Changes are highlighted
Date | 2018-08-17 | 2019-04-12 | 2019-06-07 | 2021-01-19 | 2021-08-19 |
---|---|---|---|---|---|
Name | apconfinland.fi | apconfinland.fi | apconfinland.fi | apconfinland.fi | apconfinland.fi |
State | Registered | Registered | Registered | Registered | Validity expired |
Holder | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta | Suomen Messut Osuuskunta |
Address | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 | Messuaukio 1 |
Country | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) | Finland (FI) |
GrantDate | 2018-08-16T16:21:18.903 | 2018-08-16T16:21:18.903 | 2018-08-16T16:21:18.903 | 2018-08-16T16:21:18.903 | 2018-08-16T16:21:18.903 |
Registrar | Nebula Oy | Telia Inmics-Nebula Oy | Telia Inmics-Nebula Oy | Telia Inmics-Nebula Oy | Telia Inmics-Nebula Oy |
PostalArea | Helsinki | Helsinki | Helsinki | Helsinki | Helsinki |
PostalCode | 00100 | 00100 | 00100 | 00100 | 00100 |
NameServer1 | ns1.mynebula.fi | ns1.mynebula.fi | ns.nebula.fi | ns.nebula.fi | ns.nebula.fi |
NameServer2 | ns2.mynebula.fi | ns2.mynebula.fi | ns2.nebula.fi | ns2.nebula.fi | ns2.nebula.fi |
PhoneNumber | +358505986399 | +358505986399 | +358505986399 | ||
IsDNSSecInUse | no | no | no | no | no |
OrganizationId | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 | 0116322-3 |
AssociationType | Company | Company | Company | Company | Company |
LastValidityDate | 2021-08-16T16:21:18.903 | 2021-08-16T16:21:18.903 | 2021-08-16T16:21:18.903 | 2021-08-16T16:21:18.903 | 2021-08-16T16:21:18.903 |
DepartmentOrContactPerson |
Server response for apconfinland.fi
Source: Web server reponse - Timestamp: 2021-07-01 05:26Final URL | |
HTTP Return Code | |
IP Address | |
Server Header | Server: Via: |
Certificate | Not available Using certificate is highly recommended for Search Engine Optimization (SEO) If your website has an certificate and you are still seing this warning it means that your web server is not configured properly to redirect traffic to an https address |
Used technologies on apconfinland.fi
Source: Web page analysis - Timestamp: 2021-07-01 05:26Latest review | 2021-07-01 05:26 |
Page language (from header) | en-US (This is often false!) |
Technologies | Azure (PaaS) (100% propable) Bootstrap 3.3.7 (UI Frameworks) (100% propable) Google Analytics (Analytics) (100% propable) Google Font API (Font Scripts) (100% propable) Google Tag Manager (Tag Managers) (100% propable) Hammer.js 2.0.8 (JavaScript Libraries) (100% propable) IIS 10.0 (Web Servers) (100% propable) PHP 7.3.27 (Programming Languages) (100% propable) WordPress 5.5.5 (CMSBlogs) (100% propable) jQuery 1.12.4 (JavaScript Libraries) (100% propable) jQuery UI 1.11.4 (JavaScript Libraries) (100% propable) reCAPTCHA (Captchas) (100% propable) |
Known subdomains for apconfinland.fi
Source: Search engines and DNS records (NOTICE: Most may not be reachable (internal/DMZ/obsolete)). Showing max rows 700Number of subdomains found: 1
Subdomain | IP address |
---|---|
www.apconfinland.fi | 188.117.27.178 |
Web hosting providers
Source: All valid company websites with content (see below table)
Domains owned by same owner (current and past)
Source: Finnish Transport and Communications Agency (Traficom)Number of domains: 282
Domain name | Final URL (when last tested) | Links | Last validity |
---|---|---|---|
100ideaakevaaseen.fi | Expired 2023-01-27 | ||
55plus.fi | No DNS records found | 2025-02-09 | |
agriexpo.fi | Expired 2023-11-23 | ||
agrikone.fi | Expired 2023-11-23 | ||
agrikonemessut.fi | Expired 2023-11-23 | ||
agrimessut.fi | Expired 2023-11-23 | ||
antiikkitapahtuma.fi | http://antiikki.messukeskus.com/ | 2024-11-27 | |
apconfinland.fi | Expired 2021-08-16 | ||
arenaexpo.fi | https://arena.messukeskus.com/ | 2024-06-14 | |
asujaremontoi.fi | No DNS records found | 2024-10-25 | |
atvmessut.fi | Expired 2023-03-29 | ||
auto2017.fi | Expired 2000-12-31 | ||
auto2019.fi | http://auto.messukeskus.com/ | 2026-02-08 | |
auto2020.fi | Expired 2024-02-08 | ||
auto2021.fi | Expired 2024-02-08 | ||
auto2022.fi | Expired 2024-02-08 | ||
autokorjaamomessut.fi | https://autokorjaamo.messukeskus.com/ | 2024-09-20 | |
automaatiomessut.fi | Expired 2023-09-20 | ||
auto-messut.fi | http://auto.messukeskus.com/ | 2025-01-26 | |
båtmässa.fi | No DNS records found | 2025-09-01 | |
beautyprocover.fi | http://iloveme.messukeskus.com/beauty-pro/ | 2025-05-03 | |
beautypromessut.fi | No DNS records found | 2024-12-01 | |
bioenergyexpo.fi | Expired 2023-11-18 | ||
bioproductsexpo.fi | Expired 2023-11-18 | ||
bisnespaivat.fi | Expired 2024-01-03 | ||
bisnespäivät.fi | https://messukeskus.com/wp-signup.php?new=www.xn--bisnespivt... | 2026-01-03 | |
bolearenaclub.fi | No DNS records found | 2025-05-11 | |
bolearena.fi | No DNS records found | 2025-05-11 | |
böle.fi | No DNS records found | 2025-05-11 | |
businesstravelforum.fi | https://matka.messukeskus.com/b2b/ | 2024-05-22 | |
caravanmessut.fi | https://caravan.messukeskus.com/ | 2024-09-20 | |
chembiofinland.fi | http://chembio.messukeskus.com/ | 2025-02-19 | |
congresscenter.fi | No DNS records found | 2024-06-13 | |
congresscentre.fi | Expired 2023-09-05 | ||
conventioncenter.fi | No DNS records found | 2024-06-13 | |
conventioncentre.fi | https://messukeskus.com/wp-signup.php?new=www.conventioncent... | 2027-06-13 | |
corefair.fi | Expired 2018-04-16 | ||
coremessut.fi | Expired 2018-04-16 | ||
digiexpo.fi | Expired 2024-02-19 | ||
educafair.fi | No DNS records found | 2024-10-28 | |
educamessut.fi | No DNS records found | 2025-04-07 | |
elainystavani.fi | No DNS records found | 2025-05-20 | |
eläinystäväni.fi | No DNS records found | 2025-05-20 | |
elmamessut.fi | https://elma.messukeskus.com/ | 2024-09-05 | |
eltekmessut.fi | Expired 2023-09-04 | ||
emessukeskus.fi | http://www.emessukeskus.fi/ | 2025-03-27 | |
enviroexpo.fi | Expired 2024-01-29 | ||
facetoface.fi | Expired 2023-09-07 | ||
fairnet.fi | Expired 2023-09-04 | ||
fillarimessut.fi | https://goexpo.messukeskus.com/ | 2024-09-05 | |
finlandsmassa.fi | Expired 2023-09-04 | ||
finlandsmässa.fi | Expired 2023-09-01 | ||
finnbuild.fi | No DNS records found | 2025-09-04 | |
finnexpo.fi | Expired 2023-08-31 | ||
finnishdentalexhibition.fi | No DNS records found | 2024-11-17 | |
finnishfaircorporation.fi | https://messukeskus.com/wp-signup.php?new=www.finnishfaircor... | 2024-09-04 | |
finnsec.fi | http://www.finnsec.fi/ | 2025-09-04 | |
foodtechelsinki.fi | https://pfsptec.messukeskus.com/ | 2025-04-07 | |
formakevat.fi | Expired 2023-09-03 | ||
formakevät.fi | Expired 2023-09-03 | ||
formasyksy.fi | Expired 2023-09-03 | ||
funexpo.fi | http://www.funexpo.fi/ | 2024-09-28 | |
gamexpo.fi | Expired 2023-11-17 | ||
gastro.fi | No DNS records found | 2025-09-04 | |
gastrohelsinki.fi | No DNS records found | 2025-03-20 | |
gastropro.fi | https://gastro.messukeskus.com/ | 2024-11-01 | |
globalworkshop.fi | https://matka.messukeskus.com/ | 2024-10-25 | |
goexpo.fi | https://goexpo.messukeskus.com/ | 2025-12-04 | |
goexpohorse.fi | Expired 2023-12-06 | ||
goexpowinter.fi | Expired 2023-10-17 | ||
golfexpo.fi | Expired 2024-03-05 | ||
golfmessut.fi | https://golfmessut.fi/ | 2024-09-05 | |
graftec.fi | Expired 2024-04-22 | ||
growthhelsinki.fi | Expired 2023-02-07 | ||
gswpro.fi | Expired 2000-12-31 | ||
habitare.fi | No DNS records found | 2025-08-31 | |
habitarepro.fi | http://www.habitarepro.fi/ | 2024-09-22 | |
hammalääkäripäivätnäyttely.fi | Expired 2018-11-15 | ||
hammaslaakaripaivatnayttely.fi | No DNS records found | 2024-11-15 | |
hammaslääkäripäivätnäyttely.fi | https://hammaslaakaripaivat.messukeskus.com/ | 2024-11-25 | |
helsingforsbokmassa.fi | https://kirjamessut.messukeskus.com/?lang=sv | 2024-09-05 | |
helsingforsbokmässa.fi | https://messukeskus.com/wp-signup.php?new=www.xn--helsingfor... | 2025-09-01 | |
helsingforsmasscentrum.fi | No DNS records found | 2025-09-04 | |
helsingforsmässcentrum.fi | Expired 2019-09-01 | ||
helsingineramessut.fi | No DNS records found | 2025-04-19 | |
helsinginerämessut.fi | No DNS records found | 2025-04-19 | |
helsinginkirjamessut.fi | https://kirjamessut.messukeskus.com/ | 2024-09-05 | |
helsinginmessukeskus.fi | No DNS records found | 2025-08-31 | |
helsinginmessut.fi | http://www.wanhasatama.com/ | 2025-08-31 | |
helsinginmetsamessut.fi | Expired 2024-01-08 | ||
helsinginmetsämessut.fi | Expired 2024-01-08 | ||
helsinginmusiikkimessut.fi | Expired 2023-10-22 | ||
helsinkiboatshow.fi | No DNS records found | 2024-11-17 | |
helsinkibookfair.fi | No DNS records found | 2024-09-05 | |
helsinkicf.fi | No DNS records found | 2025-04-07 | |
helsinkiconventioncenter.fi | No DNS records found | 2025-06-13 | |
helsinkiconventioncentre.fi | No DNS records found | 2025-06-13 | |
helsinkiexhibitionandconventioncenter.fi | https://messukeskus.com/?lang=en | 2025-06-13 | |
helsinkiexhibitionandconventioncentre.fi | http://www.helsinkiexhibitionandconventioncentre.fi/ | 2025-06-13 | |
helsinkiexhibitioncenter.fi | No DNS records found | 2024-06-13 | |
helsinkiexhibitioncentre.fi | No DNS records found | 2025-06-13 | |
helsinkifaircentre.fi | http://messukeskus.com/?lang=en | 2025-09-04 | |
helsinkihorsefair.fi | http://www.helsinkihorsefair.fi/ | 2024-09-20 | |
highendhelsinki.fi | Expired 2024-01-18 | ||
highendhifi.fi | Expired 2024-01-16 | ||
himss.fi | No DNS records found | 2024-11-16 | |
horsefair.fi | Expired 2024-04-23 | ||
hpmessut.fi | http://www.hpmessut.fi/ | 2024-06-07 | |
hupicon.fi | No DNS records found | 2024-10-06 | |
iloveme.fi | http://iloveme.messukeskus.com/ | 2025-01-18 | |
infraexpo.fi | Expired 2024-01-31 | ||
jatevesiymparisto.fi | No DNS records found | 2024-09-04 | |
jätevesiympäristö.fi | http://www.xn--jtevesiymprist-5hbj42a.fi/ | 2024-09-04 | |
jewelandwatch.fi | Expired 2023-11-27 | ||
jobforum.fi | Expired 2023-10-22 | ||
jointec.fi | Expired 2024-04-24 | ||
jonnela.fi | No DNS records found | 2024-10-30 | |
jonnelaklubi.fi | No DNS records found | 2024-10-30 | |
julkinenateria.fi | https://ateria.messukeskus.com/ | 2024-11-25 | |
julkisivumessut.fi | Expired 2019-01-18 | ||
kadentaitotapahtuma.fi | Expired 2024-02-26 | ||
kädentaitotapahtuma.fi | Expired 2024-02-26 | ||
kauneusmessut.fi | No DNS records found | 2025-09-04 | |
kevaanmerkit.fi | Expired 2024-03-30 | ||
keväänmerkit.fi | Expired 2024-03-30 | ||
kevatmessut.fi | http://www.kevatmessut.fi/ | 2025-01-08 | |
kevätmessut.fi | http://www.xn--kevtmessut-s5a.fi/ | 2025-01-08 | |
kevatpuutarha.fi | http://kevatmessut.messukeskus.com/ | 2025-09-04 | |
kiinteistoklusteri.fi | Expired 2024-03-29 | ||
kiinteistöklusteri.fi | Expired 2024-03-29 | ||
kiinteistomessut.fi | http://www.kiinteistomessut.fi/ | 2024-09-20 | |
kiinteistömessut.fi | No DNS records found | 2025-09-01 | |
kiinteistoplusturvallisuus.fi | Expired 2024-03-05 | ||
kiinteistöplusturvallisuus.fi | Expired 2024-03-05 | ||
kokoustamo.fi | Expired 2023-09-25 | ||
korjausjarakentaminen.fi | Expired 2023-09-07 | ||
korjausrakentaminen2018.fi | Expired 2023-10-04 | ||
korujakello.fi | Expired 2023-11-27 | ||
korujakellomessut.fi | Expired 2023-11-27 | ||
kuljetuslogistiikka.fi | Expired 2023-09-05 | ||
kutsutapahtumaan.fi | No DNS records found | 2024-10-25 | |
laakaripaivatnayttely.fi | https://laakaripaivat.messukeskus.com/ | 2024-09-20 | |
lääkäripäivätnäyttely.fi | No DNS records found | 2025-09-01 | |
lahiruokaluomu.fi | https://lahiruokajaluomu.messukeskus.com/ | 2024-09-21 | |
lähiruokaluomu.fi | https://kevatmessut.messukeskus.com/ | 2024-09-21 | |
lapsimessut.fi | https://lapsimessut.messukeskus.com/ | 2024-09-05 | |
lautasella.fi | No DNS records found | 2025-06-08 | |
lemmikkitapahtuma.fi | No DNS records found | 2024-12-16 | |
liikelahjamessut.fi | Expired 2019-10-30 | ||
liikelahjatmessut.fi | Expired 2019-10-30 | ||
logistiikkakuljetus.fi | Expired 2023-09-05 | ||
maatalouskonemessut.fi | https://maatalouskone.messukeskus.com/ | 2024-11-23 | |
maintec.fi | Expired 2018-04-22 | ||
manufacturingmaterials.fi | Expired 2023-10-30 | ||
markkinoinninviikko.fi | Expired 2024-03-09 | ||
matkahuutokauppa.fi | Expired 2019-12-13 | ||
matkailupalkinto.fi | Expired 2018-11-30 | ||
matkamessut.fi | No DNS records found | 2024-09-05 | |
matkapro.fi | No DNS records found | 2024-11-20 | |
maxpo.fi | http://www.maxpo.fi/ | 2025-09-04 | |
mecatec.fi | Expired 2023-08-31 | ||
meetfinland.fi | No DNS records found | 2024-09-28 | |
meidanviikonloppu.fi | Expired 2024-02-18 | ||
meidänviikonloppu.fi | Expired 2024-02-18 | ||
mesoaja.fi | http://www.mesoaja.fi/ | 2024-07-31 | |
messuhelmi.fi | Expired 2018-05-29 | ||
messukeskus100.fi | Expired 2023-11-20 | ||
messukeskushelsinki.fi | No DNS records found | 2024-10-10 | |
messukirppis.fi | Expired 2019-02-06 | ||
messuklubi.fi | No DNS records found | 2024-09-18 | |
messukutsu.fi | No DNS records found | 2024-05-22 | |
messumedia.fi | http://www.messumedia.fi/ | 2025-09-04 | |
messuparkki.fi | No DNS records found | 2025-05-29 | |
messut100.fi | No DNS records found | 2025-12-13 | |
messutapahtumat.fi | No DNS records found | 2024-09-20 | |
messuvalmennus.fi | No DNS records found | 2025-01-14 | |
metsamessut.fi | https://metsa.messukeskus.com/ | 2025-05-16 | |
metsämessut.fi | No DNS records found | 2024-05-16 | |
metsastysmessut.fi | Expired 2024-04-22 | ||
metsästysmessut.fi | Expired 2019-04-22 | ||
model-expo.fi | Expired 2023-10-14 | ||
modelexpo.fi | Expired 2023-10-14 | ||
moottorikelkkamessut.fi | Expired 2024-03-29 | ||
moottoripyoranayttely.fi | Expired 2024-02-19 | ||
moottoripyöränäyttely.fi | No DNS records found | 2025-09-01 | |
motokuume.fi | http://www.motokuume.fi/ | 2024-12-04 | |
motokuumemittari.fi | Expired 2024-01-21 | ||
mp-messut.fi | No DNS records found | 2024-09-29 | |
mpmessut.fi | http://mp.messukeskus.com/ | 2025-02-21 | |
mp-nayttely.fi | http://www.mp-nayttely.fi/ | 2025-02-19 | |
mprock.fi | Expired 2023-06-21 | ||
mpstars.fi | Expired 2023-11-02 | ||
muotimessut.fi | No DNS records found | 2025-09-04 | |
nayttely.fi | Expired 2023-09-05 | ||
nbe.fi | Expired 2023-09-11 | ||
nordictravelfair.fi | http://matka.messukeskus.com/?lang=en | 2024-10-06 | |
oispatalvi.fi | http://www.oispatalvi.fi/ | 2024-09-14 | |
omakotimessut.fi | http://kevatmessut.messukeskus.com/ | 2024-09-20 | |
omamokki.fi | No DNS records found | 2025-09-04 | |
omamökki.fi | No DNS records found | 2025-09-01 | |
omapiha.fi | No DNS records found | 2025-09-04 | |
onseala.fi | No DNS records found | 2025-03-21 | |
outdoorexpo.fi | http://www.outdoorexpo.fi/ | 2024-12-16 | |
pactec.fi | No DNS records found | 2025-08-31 | |
petrolcircus.fi | No DNS records found | 2024-11-17 | |
plastexpo.fi | Expired 2023-09-24 | ||
pomppulinnataivas.fi | Expired 2023-10-25 | ||
pranabeats.fi | Expired 2019-10-13 | ||
pratkakuume.fi | Expired 2018-06-08 | ||
promoexpo.fi | Expired 2023-11-21 | ||
pulpandbeyond.fi | No DNS records found | 2025-05-11 | |
pulpaper.fi | No DNS records found | 2025-09-04 | |
pwaexpo.fi | Expired 2021-04-27 | ||
pwa.fi | Expired 2024-04-27 | ||
reset16.fi | Expired 2020-01-29 | ||
reset17.fi | Expired 2019-08-18 | ||
reset2017.fi | Expired 2019-08-17 | ||
retkimessut.fi | Expired 2024-02-19 | ||
robtec.fi | Expired 2000-12-31 | ||
ruokamessuthelsinki.fi | No DNS records found | 2025-01-09 | |
sahko-electricity.fi | No DNS records found | 2025-03-25 | |
sähkö-electricity.fi | No DNS records found | 2025-03-25 | |
sahkoexpo.fi | http://www.sahkoexpo.fi/ | 2025-03-25 | |
sähköexpo.fi | No DNS records found | 2025-03-25 | |
sähkömessut.fi | No DNS records found | 2025-02-15 | |
sairaanhoitajapaivatnayttely.fi | No DNS records found | 2025-04-20 | |
sairaanhoitajapäivätnäyttely.fi | No DNS records found | 2025-04-20 | |
seatechelsinki.fi | Expired 2000-12-31 | ||
secd-day.fi | No DNS records found | 2025-02-19 | |
seonala.fi | No DNS records found | 2025-04-19 | |
showroomfair.fi | Expired 2023-11-23 | ||
signtec.fi | Expired 2024-01-29 | ||
sihteeriassistenttimessut.fi | Expired 2023-10-30 | ||
sihteeriassistenttipaivat.fi | Expired 2023-10-30 | ||
sihteeriassistenttipäivät.fi | Expired 2023-10-30 | ||
sijoittaja23.fi | No DNS records found | 2025-05-15 | |
sijoittaja25.fi | No DNS records found | 2025-05-15 | |
sijoittaja26.fi | No DNS records found | 2025-05-15 | |
sijoittaja27.fi | No DNS records found | 2025-05-15 | |
sijoittajamessut.fi | https://sijoittajamessut.messukeskus.com/ | 2025-01-08 | |
sisahuvipuisto.fi | No DNS records found | 2024-06-13 | |
sisustamessut.fi | https://kevatmessut.messukeskus.com/ | 2024-06-14 | |
sporttitaivas.fi | https://messukeskus.com/wp-signup.php?new=www.sporttitaivas.... | 2024-06-15 | |
studiamessut.fi | http://studia.messukeskus.com/ | 2024-10-29 | |
suomenmessut.fi | http://messukeskus.com/ | 2025-08-31 | |
suomenmetsamessut.fi | No DNS records found | 2026-07-03 | |
suomenmetsämessut.fi | No DNS records found | 2024-07-03 | |
suomenvideoviestinta.fi | http://www.suomenvideoviestinta.fi/ | 2025-08-24 | |
svv.fi | https://svv.fi/ | 2024-09-04 | |
tanssiviekoon.fi | Expired 2023-12-22 | ||
teknologia17.fi | Expired 2019-03-19 | ||
teknologia19.fi | Expired 2024-03-19 | ||
teknologia21.fi | https://teknologia.messukeskus.com/ | 2024-10-16 | |
teknologia22.fi | No DNS records found | 2024-09-28 | |
teknologia23.fi | No DNS records found | 2025-02-20 | |
teknologiatapahtuma.fi | No DNS records found | 2024-08-16 | |
tempaudu.fi | No DNS records found | 2025-08-14 | |
terveysmessut.fi | No DNS records found | 2025-09-04 | |
terveytesimessut.fi | No DNS records found | 2024-06-08 | |
tooltec.fi | https://teknologia.messukeskus.com/ | 2026-05-08 | |
travelfair.fi | http://www.travelfair.fi/ | 2024-10-06 | |
tsigaboom.fi | https://tsigaboom.messukeskus.com/ | 2024-08-15 | |
turvallisuus2021.fi | Expired 2023-04-09 | ||
turvallisuusmessut2021.fi | Expired 2023-04-09 | ||
turvallisuustapahtuma.fi | No DNS records found | 2024-09-27 | |
valomessut.fi | http://www.valomessut.fi/ | 2027-03-30 | |
valotapahtuma.fi | Expired 2024-03-30 | ||
varipinta.fi | Expired 2023-09-05 | ||
väripinta.fi | Expired 2023-09-01 | ||
venemessut.fi | http://vene.messukeskus.com/ | 2025-09-04 | |
vihertek.fi | Expired 2023-11-04 | ||
viiniexpo.fi | Expired 2023-09-04 | ||
viiniruoka.fi | http://www.viiniruoka.fi/ | 2025-04-28 | |
visitmatka.fi | No DNS records found | 2025-08-31 | |
winterexpo.fi | Expired 2023-10-17 | ||
woodexpo.fi | Expired 2023-11-18 | ||
ymparistomessut.fi | Expired 2023-09-05 | ||
ympäristömessut.fi | Expired 2023-09-01 | ||
ymparistotekniikkamessut.fi | http://www.ymparistotekniikkamessut.fi/ | 2024-06-06 | |
ympäristötekniikkamessut.fi | https://messukeskus.com/wp-signup.php?new=www.xn--ympristtek... | 2024-06-06 | |
yritys2017.fi | Expired 2021-02-03 | ||
yritys2018.fi | No DNS records found | 2027-01-26 |